y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCucumis sativus
Cazyme IDCucsa.002900.4
FamilyGT8
Protein PropertiesLength: 589 Molecular Weight: 66978.6 Isoelectric Point: 6.8307
ChromosomeChromosome/Scaffold: 00034 Start: 71170 End: 80067
Descriptiongalacturonosyltransferase 7
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT82715600
  CLSMQLTVEYFRIYSTKLELSQAEKYSDPTLNHYIIFSNNILASSVVINSTVSNSKESRNQVFHVLTDGQNYFAMNLWFLRNSYEEAAVEVINVEQLKLD
  DHENVTFVLPQEFRISFRTLTHSRTEYISMFSHLHYLLPEIFKNLDKVVVLEDDVIVQRDLSALWSLDMDGKVNGAAQCCHVRLGELKSILGENGYVQND
  CTWMSGLNVIDLAKWRELDLSQTFRSLVREGGSTDAVALRASLLTFQSLIYALDDSWSLYGLGHDYKLNVQDVENAATLHYNGYLKPWLE
Full Sequence
Protein Sequence     Length: 589     Download
MKGGGGGGSG ASAYGFPAKR RWRGLVIGVL GLVILSMLVP LVFLLGLYNG FHTAGYASDP    60
QNSKPDVFQK YAIEPKKETV DFIHESQEPK GLPPPKVDAL PKHTHENSTK VGGRVQPTDR    120
MTAVDESGKP CEWKFGSYCI WRQEHREVIK DSMVKKLKDQ LFVARAYYPT IAKLPTQSQL    180
TQEMKQNIQE LERVLSESTT DLDLPLQIEK KSLKMEATIA KAKSFPVDCN NVDKKLRQIF    240
DMTEDEANFH MKQSAFLFQL AVQTMPKSMH CLSMQLTVEY FRIYSTKLEL SQAEKYSDPT    300
LNHYIIFSNN ILASSVVINS TVSNSKESRN QVFHVLTDGQ NYFAMNLWFL RNSYEEAAVE    360
VINVEQLKLD DHENVTFVLP QEFRISFRTL THSRTEYISM FSHLHYLLPE IFKNLDKVVV    420
LEDDVIVQRD LSALWSLDMD GKVNGAAQCC HVRLGELKSI LGENGYVQND CTWMSGLNVI    480
DLAKWRELDL SQTFRSLVRE GGSTDAVALR ASLLTFQSLI YALDDSWSLY GLGHDYKLNV    540
QDVENAATLH YNGYLKPWLE LGIPKYKAYW KKFLDREDLF LSKCNINP*                600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd06429GT8_like_13.0e-80303575279+
PLN02718PLN027181.0e-101147586461+
PLN02910PLN029107.0e-103136587484+
PLN02829PLN028292.0e-108148588470+
PLN02769PLN02769016587620+
Gene Ontology
GO TermDescription
GO:0016757transferase activity, transferring glycosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABN08312.1045873644Glycosyl transferase, family 8 [Medicago truncatula]
EMBLCAQ58617.1012258857541transferase, transferring glycosyl groups / unknown protein [Vitis vinifera]
RefSeqXP_002264525.101258811613PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002326255.1010658897590glycosyltransferase [Populus trichocarpa]
RefSeqXP_002519984.1012258798575Glycosyltransferase QUASIMODO1, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ga8_A0.00239655877252A Chain A, Crystal Structural Analysis Of Active Site Mutant Q189e Of Lgtc
PDB1g9r_A0.00239655877252A Chain A, Crystal Structure Of Galactosyltransferase Lgtc In Complex With Mn And Udp-2f-Galactose
PDB1ss9_A0.00839655877252A Chain A, Crystal Structural Analysis Of Active Site Mutant Q189e Of Lgtc
Transmembrane Domains
StartEnd
2547
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX2882353271594840
EE6085002701313990
EE6103532701344020
EX0499772331343660
GR0627812631934470
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00589.1Aquca_004_00589.4Aquca_004_00589.2Aquca_004_00589.3Aquca_004_00589.5
Aquca_004_00589.6Aquca_004_00589.7Aquca_004_00589.8Aquca_004_00589.9
Arabidopsis lyrata482874
Arabidopsis thalianaAT2G38650.1AT2G38650.2
Brachypodium distachyonBradi1g63520.1Bradi4g44070.1Bradi1g17570.1Bradi3g61120.1
Brassica rapaBra017110Bra005091Bra000081
Carica papayaevm.model.supercontig_63.51
Capsella rubellaCarubv10022827mCarubv10022960m
Citrus clementinaCiclev10011265mCiclev10011297m
Citrus sinensisorange1.1g006506morange1.1g006959morange1.1g010099m
Cucumis sativusCucsa.002900.3Cucsa.002900.1
Eucalyptus grandisEucgr.A00881.2Eucgr.A00881.1
Fragaria vescamrna13645.1-v1.0-hybrid
Glycine maxGlyma16g09405.1Glyma18g45226.1Glyma09g40610.2
Gossypium raimondiiGorai.005G129100.4Gorai.005G129100.5Gorai.005G129100.2Gorai.006G236100.1Gorai.006G236100.2
Gorai.006G236100.3Gorai.006G236100.4Gorai.005G129100.1Gorai.005G129100.3
Linum usitatissimumLus10003235Lus10035615
Malus domesticaMDP0000922484MDP0000174912
Manihot esculentacassava4.1_005865mcassava4.1_034453m
Medicago truncatulaMedtr7g074680.1
Mimulus guttatusmgv1a002878m
Oryza sativaLOC_Os11g03160.1LOC_Os03g21250.1LOC_Os07g48370.1LOC_Os05g40720.1LOC_Os12g02910.1
Panicum virgatumPavirv00000593mPavirv00014347mPavirv00006239mPavirv00024569mPavirv00069223m
Pavirv00024467mPavirv00048424mPavirv00040432mPavirv00034218mPavirv00014348m
Phaseolus vulgarisPhvul.008G076900.1
Picea abiesMA_118216g0010
Populus trichocarpaPotri.T138200.1Potri.016G144000.1Potri.016G144000.2Potri.006G114300.1Potri.006G114300.2
Potri.006G114300.3Potri.006G114300.4
Prunus persicappa002860m
Ricinus communis30073.m002205
Setaria italicaSi009553mSi029187mSi026080mSi021466mSi034649m
Sorghum bicolorSb09g023760.1Sb01g036430.1Sb02g043170.1Sb08g002010.1
Thellungiella halophilaThhalv10016387mThhalv10016389m
Vitis viniferaGSVIVT01029827001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)