CAZyme Information

Basic Information
SpeciesCucumis sativus
Cazyme IDCucsa.018320.10
FamilyGT77
Protein PropertiesLength: 534 Molecular Weight: 61228.4 Isoelectric Point: 5.9086
ChromosomeChromosome/Scaffold: 00252 Start: 749319 End: 756886
Descriptionxyloglucanase 113
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT77482720
  LTNLLVGAMDTKLLEALYWKGIPVFDMGSHMSTVDVGWGSPTFHKMGREKVILIDSILPYGVELLMCDTDMVWLKNPLPYLARYPAADVLTSSDQVVPTV
  VDDRLDKWNEVTGALNIGIFHWRPTEASKKLAKEWKEMLLADDKIWDQNGFNELVHKKYGPSVDEDSELVYAYDGNLKLGVLPASIFCSGHTYFVQAMYQ
  QFRLEPYAVHTTFQYAGTEGKRHRL
Full Sequence
Protein Sequence     Length: 534     Download
MPPPEAFNLS KELVQKRAKD NIIIVTFGNY AFMDFILSWV KHLTDLGLTN LLVGAMDTKL    60
LEALYWKGIP VFDMGSHMST VDVGWGSPTF HKMGREKVIL IDSILPYGVE LLMCDTDMVW    120
LKNPLPYLAR YPAADVLTSS DQVVPTVVDD RLDKWNEVTG ALNIGIFHWR PTEASKKLAK    180
EWKEMLLADD KIWDQNGFNE LVHKKYGPSV DEDSELVYAY DGNLKLGVLP ASIFCSGHTY    240
FVQAMYQQFR LEPYAVHTTF QYAGTEGKRH RLREAMVFFD PPEYFDAPGG YLSFKPSIPK    300
NLVLEGEHNL DTHFTLINYQ MKQIRTALAI ASLLNRTLIM PPLWCRLDRL WFGHPGVLQG    360
SVTRQPFICP LDHVFEVNVM LKELPEEEFG PGIDFREYSF LENPLLPKQV KESWLDVQLC    420
KQESEGCSAS NDTVLPGVLK FPKGSNEDTF KAIFSTFKDV KVIQFSTMQD AFPGFSDKKR    480
EEKFRNRVKR YVGIWCCVEN AAPGHIYYDM YWDEKPNWKP HPPRTPEEDR PPL*          540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans6.0e-5048272231+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI29197.102532112641unnamed protein product [Vitis vinifera]
RefSeqNP_850250.101533112644unknown protein [Arabidopsis thaliana]
RefSeqXP_002269181.102532181710PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002328759.102532107637predicted protein [Populus trichocarpa]
RefSeqXP_002519934.101532108638reticulon3-A3, putative [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT511993302223230
EX130872295913850
EV235113334864140
GR708401298343310
DT567046285443280
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00317.5Aquca_011_00317.4Aquca_011_00317.3Aquca_011_00317.2Aquca_011_00317.1
Arabidopsis lyrata902666
Arabidopsis thalianaAT2G35610.1
Brachypodium distachyonBradi1g15410.1Bradi3g45950.1
Brassica rapaBra017310Bra005325
Carica papayaevm.model.supercontig_90.39
Capsella rubellaCarubv10022808m
Chlamydomonas reinhardtiig13982.t1g15149.t1Cre02.g082950.t1.3Cre01.g000400.t1.2Cre01.g000450.t1.2
g4580.t1Cre07.g340950.t1.3Cre04.g224350.t1.3Cre01.g000500.t1.3Cre09.g416650.t1.2
Cre13.g574100.t1.2Cre13.g574041.t1.1Cre13.g574050.t1.2Cre07.g332500.t1.2
Citrus clementinaCiclev10011269m
Citrus sinensisorange1.1g036925m
Cucumis sativusCucsa.018320.1Cucsa.018320.3
Eucalyptus grandisEucgr.E01147.2Eucgr.E01147.1
Fragaria vescamrna10921.1-v1.0-hybrid
Glycine maxGlyma11g09650.2Glyma01g35690.1Glyma16g08350.1Glyma16g20730.1Glyma16g08350.3
Glyma16g08350.2
Gossypium raimondiiGorai.004G177500.4Gorai.008G219000.2Gorai.004G177500.5Gorai.004G177500.6Gorai.004G177500.7
Gorai.004G177500.9Gorai.004G177500.2Gorai.004G177500.3Gorai.004G177500.1Gorai.008G219000.1
Gorai.004G177500.8
Linum usitatissimumLus10005034Lus10027804
Malus domesticaMDP0000349223
Manihot esculentacassava4.1_003398mcassava4.1_008884m
Medicago truncatulaMedtr8g072310.1Medtr5g025590.1
Mimulus guttatusmgv1a002766m
Oryza sativaLOC_Os03g38930.1
Panicum virgatumPavirv00057126mPavirv00045617mPavirv00069114m
Physcomitrella patensPp1s46_165V6.1
Phaseolus vulgarisPhvul.003G278500.1Phvul.002G122000.1
Picea abiesMA_486176g0010MA_10433213g0010
Populus trichocarpaPotri.004G235800.1Potri.004G235800.2
Prunus persicappa002815m
Ricinus communis29827.m002651
Setaria italicaSi034728m
Selaginella moellendorffii127789
Sorghum bicolorSb01g015590.1
Thellungiella halophilaThhalv10016368m
Vitis viniferaGSVIVT01036881001
Volvox carteriVocar20007251mVocar20009385mVocar20010418mVocar20002020mVocar20004159m
Vocar20001219mVocar20001335mVocar20001723mVocar20006862mVocar20009663m
Vocar20008350mVocar20001348m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)