CAZyme Information

Basic Information
SpeciesCucumis sativus
Cazyme IDCucsa.018320.3
FamilyGT77
Protein PropertiesLength: 641 Molecular Weight: 72752.1 Isoelectric Point: 5.5232
ChromosomeChromosome/Scaffold: 00252 Start: 749372 End: 756886
Descriptionxyloglucanase 113
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT771553790
  LTNLLVGAMDTKLLEALYWKGIPVFDMGSHMSTVDVGWGSPTFHKMGREKVILIDSILPYGVELLMCDTDMVWLKNPLPYLARYPAADVLTSSDQVVPTV
  VDDRLDKWNEVTGALNIGIFHWRPTEASKKLAKEWKEMLLADDKIWDQNGFNELVHKKYGPSVDEDSELVYAYDGNLKLGVLPASIFCSGHTYFVQAMYQ
  QFRLEPYAVHTTFQYAGTEGKRHRL
Full Sequence
Protein Sequence     Length: 641     Download
MGLGNGCQDG VNTRPLFLVI YATVIAGIVF SSLYVFSAVY SSSNSVSDSS SWFSSTSSEF    60
TNFDSTLIKD QRSDVSQPST GPTPDFSNTV VQNKGERPIW EAPNTKNMPP PEAFNLSKEL    120
VQKRAKDNII IVTFGNYAFM DFILSWVKHL TDLGLTNLLV GAMDTKLLEA LYWKGIPVFD    180
MGSHMSTVDV GWGSPTFHKM GREKVILIDS ILPYGVELLM CDTDMVWLKN PLPYLARYPA    240
ADVLTSSDQV VPTVVDDRLD KWNEVTGALN IGIFHWRPTE ASKKLAKEWK EMLLADDKIW    300
DQNGFNELVH KKYGPSVDED SELVYAYDGN LKLGVLPASI FCSGHTYFVQ AMYQQFRLEP    360
YAVHTTFQYA GTEGKRHRLR EAMVFFDPPE YFDAPGGYLS FKPSIPKNLV LEGEHNLDTH    420
FTLINYQMKQ IRTALAIASL LNRTLIMPPL WCRLDRLWFG HPGVLQGSVT RQPFICPLDH    480
VFEVNVMLKE LPEEEFGPGI DFREYSFLEN PLLPKQVKES WLDVQLCKQE SEGCSASNDT    540
VLPGVLKFPK GSNEDTFKAI FSTFKDVKVI QFSTMQDAFP GFSDKKREEK FRNRVKRYVG    600
IWCCVENAAP GHIYYDMYWD EKPNWKPHPP RTPEEDRPPL * 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans5.0e-50155379231+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI29197.104763941641unnamed protein product [Vitis vinifera]
RefSeqNP_850250.1099640102644unknown protein [Arabidopsis thaliana]
RefSeqXP_002269181.1092639163710PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002328759.107463974637predicted protein [Populus trichocarpa]
RefSeqXP_002519934.1056396638reticulon3-A3, putative [Ricinus communis]
Transmembrane Domains
StartEnd
1537
128147
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT5119933021294300
EX1308722951984920
EV2351133341935210
GR7084012981414380
DT5670462851514350
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00317.5Aquca_011_00317.4Aquca_011_00317.3Aquca_011_00317.2Aquca_011_00317.1
Arabidopsis lyrata902666
Arabidopsis thalianaAT2G35610.1
Brachypodium distachyonBradi1g15410.1Bradi3g45950.1
Brassica rapaBra017310Bra005325
Carica papayaevm.model.supercontig_90.39
Capsella rubellaCarubv10022808m
Chlamydomonas reinhardtiig13982.t1g15149.t1Cre02.g082950.t1.3Cre01.g000400.t1.2Cre01.g000450.t1.2
g4580.t1Cre07.g340950.t1.3Cre04.g224350.t1.3Cre01.g000500.t1.3Cre09.g416650.t1.2
Cre13.g574100.t1.2Cre13.g574041.t1.1Cre13.g574050.t1.2Cre07.g332500.t1.2
Citrus clementinaCiclev10011269m
Citrus sinensisorange1.1g036925m
Cucumis sativusCucsa.018320.1Cucsa.018320.10
Eucalyptus grandisEucgr.E01147.2Eucgr.E01147.1
Fragaria vescamrna10921.1-v1.0-hybrid
Glycine maxGlyma11g09650.2Glyma01g35690.1Glyma16g08350.1Glyma16g20730.1Glyma16g08350.3
Glyma16g08350.2
Gossypium raimondiiGorai.004G177500.4Gorai.008G219000.2Gorai.004G177500.5Gorai.004G177500.6Gorai.004G177500.7
Gorai.004G177500.9Gorai.004G177500.2Gorai.004G177500.3Gorai.004G177500.1Gorai.008G219000.1
Gorai.004G177500.8
Linum usitatissimumLus10005034Lus10027804
Malus domesticaMDP0000349223
Manihot esculentacassava4.1_003398mcassava4.1_008884m
Medicago truncatulaMedtr8g072310.1Medtr5g025590.1
Mimulus guttatusmgv1a002766m
Oryza sativaLOC_Os03g38930.1
Panicum virgatumPavirv00057126mPavirv00045617mPavirv00069114m
Physcomitrella patensPp1s46_165V6.1
Phaseolus vulgarisPhvul.003G278500.1Phvul.002G122000.1
Picea abiesMA_486176g0010MA_10433213g0010
Populus trichocarpaPotri.004G235800.1Potri.004G235800.2
Prunus persicappa002815m
Ricinus communis29827.m002651
Setaria italicaSi034728m
Selaginella moellendorffii127789
Sorghum bicolorSb01g015590.1
Thellungiella halophilaThhalv10016368m
Vitis viniferaGSVIVT01036881001
Volvox carteriVocar20007251mVocar20009385mVocar20010418mVocar20002020mVocar20004159m
Vocar20001219mVocar20001335mVocar20001723mVocar20006862mVocar20009663m
Vocar20008350mVocar20001348m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)