y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCucumis sativus
Cazyme IDCucsa.023010.1
FamilyGH116
Protein PropertiesLength: 952 Molecular Weight: 107210 Isoelectric Point: 6.2
ChromosomeChromosome/Scaffold: 00320 Start: 289896 End: 299386
DescriptionBeta-glucosidase, GBA2 type family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1165318920
  GQFLYLEGVEYTMWNTYDVHFYSSFAIIMLFPKLELSIQRDFAAAVMMHDPSKMQLLDNGKWEARNVLGAVPHDIGVNDPWFEVNGYNLYNTDRWKDLNP
  KFVLQIYRDVVATGDMKFAKAVWPPVYLAIAYMDQFDRDGDGMIENDGFPDQTYDTWSVSGVSAYSGGLWVAALQAASALARVADEKDAEHYFWFKFQKA
  KRAYEKLWNGSYFNYDSSGGSSSSSIQADQLAGQWYARASGLLPIVDEDKAKSALAKVYNYNVMKVKDGKRGAVNGMLPDGTIDFSSMQSREIWSGVTYA
  VAASMIHEDMTDMAFRTAEGIHEAAWSEDGLGYNFQTPEAWTTTDRYRSLCYMRPLAIWAMQ
Full Sequence
Protein Sequence     Length: 952     Download
MSEGKKLGNG LVEQDEDINK SLTEKTGIDP GQTPSLTWQR KLNREGTSLW QFRLHLKEII    60
HLAPVGYRLF RYIREESVKG RGAMINPFIR RRITDTHAIP LGGLGSGSIG RSYRGEFQRW    120
QLFPRKCEDK PILANQFSVF VSRPNAEKYS TVLCAQSPET QREVESSGIG SWDWNLKGHS    180
STYHALYPRA WTIYDGEPDP ELRIVCRQIS PVIPHNYKES SYPVSVFTFT LHNSGKTDAD    240
VSLLFTWANS VGGLSEYSGN HINSRTKKKD GVHTVLLHHK TASGFPPVTY AIAAQEGNGV    300
HVSDCPCFVI SGNSQGISAK DMWLEIKEHG SFDRLKFADM SMPSEVGSSI GAAVSASVTV    360
SSDSVRTVTF SLSWDCPEVN FCRGKTYHRR YTKFYGNLGD AAADIARDAI LEHHHWESQI    420
DAWQRPVLED KRFPKWYPVT LFNELYYLNA GGTIWTDGSL PIQSLVSIGE RGFCLDQCRS    480
GDSVIYESHE NDTANDILGR MTSRLDELRD SVASNSAFGV NLLQKGEENV GQFLYLEGVE    540
YTMWNTYDVH FYSSFAIIML FPKLELSIQR DFAAAVMMHD PSKMQLLDNG KWEARNVLGA    600
VPHDIGVNDP WFEVNGYNLY NTDRWKDLNP KFVLQIYRDV VATGDMKFAK AVWPPVYLAI    660
AYMDQFDRDG DGMIENDGFP DQTYDTWSVS GVSAYSGGLW VAALQAASAL ARVADEKDAE    720
HYFWFKFQKA KRAYEKLWNG SYFNYDSSGG SSSSSIQADQ LAGQWYARAS GLLPIVDEDK    780
AKSALAKVYN YNVMKVKDGK RGAVNGMLPD GTIDFSSMQS REIWSGVTYA VAASMIHEDM    840
TDMAFRTAEG IHEAAWSEDG LGYNFQTPEA WTTTDRYRSL CYMRPLAIWA MQWAFSEKVS    900
VIEELKELDS DAISRHHARF SKVARYLKLP EDGTSSSVLQ TVYDYTLKRF F*            960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG4354COG43543.0e-19134457330+
pfam12215GBA2_N3.0e-41116399295+
COG4354COG43543.0e-65530891382+
pfam04685DUF6084.0e-156531893367+
Gene Ontology
GO TermDescription
GO:0004348glucosylceramidase activity
GO:0006665sphingolipid metabolic process
GO:0016021integral to membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_199801.20119516956catalytic/ glucosylceramidase [Arabidopsis thaliana]
RefSeqXP_002264575.1099514948PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002328722.10289502922predicted protein [Populus trichocarpa]
RefSeqXP_002331126.1019501945predicted protein [Populus trichocarpa]
RefSeqXP_002528846.1019501949conserved hypothetical protein [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG7030273285498760
JG7040912995788760
JG7051212985798760
DY2920403745449100
FC8953222914117000
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00087.2Aquca_017_00087.1Aquca_034_00116.1
Arabidopsis lyrata331392479911473529327181
Arabidopsis thalianaAT1G33700.2AT1G33700.1AT5G49900.1AT3G24180.2AT3G24180.1
AT4G10060.1
Brachypodium distachyonBradi3g28580.1Bradi4g21277.1Bradi3g13487.1Bradi1g28847.1Bradi3g13520.1
Brassica rapaBra014964Bra028008Bra000598Bra028320Bra033199
Carica papayaevm.model.supercontig_59.121evm.model.supercontig_21.79evm.model.supercontig_113.12
Capsella rubellaCarubv10025826mCarubv10012912mCarubv10008221mCarubv10002637m
Citrus clementinaCiclev10004255mCiclev10000199mCiclev10018743mCiclev10018742m
Citrus sinensisorange1.1g039165morange1.1g002202morange1.1g038924m
Cucumis sativusCucsa.266300.2Cucsa.266300.1Cucsa.237200.1Cucsa.237200.2
Eucalyptus grandisEucgr.I02786.1Eucgr.H02851.2Eucgr.H02851.1Eucgr.H00075.1Eucgr.F02980.1
Eucgr.F02980.2
Fragaria vescamrna29905.1-v1.0-hybridmrna02278.1-v1.0-hybrid
Glycine maxGlyma10g33610.1Glyma20g33990.1Glyma07g40310.2
Gossypium raimondiiGorai.008G046700.1Gorai.011G160300.5Gorai.011G160300.4Gorai.011G160300.3Gorai.011G160300.2
Gorai.011G160300.1Gorai.013G133800.2Gorai.013G133800.1Gorai.006G221200.3Gorai.006G221200.2
Gorai.006G221200.1Gorai.008G046700.3Gorai.008G046700.2.531.722Gorai.008G046700.2.531.722Gorai.008G046700.2.724.851
Gorai.008G046700.2.724.851
Linum usitatissimumLus10000757Lus10003517Lus10002950Lus10023340Lus10038471
Lus10038469
Malus domesticaMDP0000175141MDP0000220028MDP0000128604
Manihot esculentacassava4.1_001108mcassava4.1_002224mcassava4.1_003299mcassava4.1_005809m
Medicago truncatulaMedtr1g072720.1Medtr1g072680.1
Mimulus guttatusmgv1a000876mmgv1a000873m
Oryza sativaLOC_Os10g33420.1LOC_Os11g13810.1LOC_Os08g01940.2LOC_Os08g01940.1LOC_Os07g26210.1
LOC_Os07g26210.2
Panicum virgatumPavirv00047844mPavirv00042892mPavirv00041095mPavirv00002207mPavirv00050055m
Pavirv00014420mPavirv00035631mPavirv00038108m
Physcomitrella patensPp1s134_55V6.1Pp1s40_202V6.1
Phaseolus vulgarisPhvul.007G134300.1Phvul.003G075400.1
Picea abiesMA_10430605g0020MA_10431145g0020MA_61180g0010MA_35878g0010MA_10426003g0020.110.198
MA_10426003g0020.110.198MA_165077g0010
Populus trichocarpaPotri.T163400.1Potri.019G072800.2Potri.019G072800.1Potri.004G227200.4Potri.004G227200.2
Potri.004G227200.1Potri.003G178000.4Potri.003G178000.3Potri.003G178000.2Potri.003G178000.1
Potri.003G003400.1Potri.003G003400.2Potri.019G072800.3Potri.004G227200.3Potri.003G003400.3
Prunus persicappa001012mppa000954m
Ricinus communis29685.m00048429757.m00075229904.m002967
Setaria italicaSi034088mSi026057mSi025923mSi029270mSi028945m
Si028854mSi013210mSi026013m
Selaginella moellendorffii16663492385
Sorghum bicolorSb01g019510.2Sb01g019510.1Sb05g007160.1Sb0073s002050.1Sb07g001140.1
Thellungiella halophilaThhalv10006714mThhalv10012588mThhalv10020003mThhalv10020001m
Vitis viniferaGSVIVT01036381001GSVIVT01023217001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)