Basic Information | |
---|---|
Species | Cucumis sativus |
Cazyme ID | Cucsa.051640.1 |
Family | AA2 |
Protein Properties | Length: 227 Molecular Weight: 24955.6 Isoelectric Point: 7.3225 |
Chromosome | Chromosome/Scaffold: 00560 Start: 28149 End: 30485 |
Description | ascorbate peroxidase 1 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 28 | 198 | 0 |
AEKHCSPLMLRLAWHSAGTFDVKTRTGGPFGTMKNAAELAHEANRGLDIAVKLLEPIKEQVPILSYGDFYQLAGVVAIEVTGGPEIPFHPGREDKPEPPP EGRLPDAAKGCDHLRDVFYSMGLSDQDIVALSGAHTLGKAHKDRSGFEGPWTKNHLIFDNSYFKEILSDDK |
Full Sequence |
---|
Protein Sequence Length: 227 Download |
MGKSYPTVSH EYQTAITKAR RKIRALVAEK HCSPLMLRLA WHSAGTFDVK TRTGGPFGTM 60 KNAAELAHEA NRGLDIAVKL LEPIKEQVPI LSYGDFYQLA GVVAIEVTGG PEIPFHPGRE 120 DKPEPPPEGR LPDAAKGCDH LRDVFYSMGL SDQDIVALSG AHTLGKAHKD RSGFEGPWTK 180 NHLIFDNSYF KEILSDDKPE LLKLPSDKAL LTDPVFRPLV ERYAAV* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd00314 | plant_peroxidase_like | 2.0e-56 | 28 | 226 | 226 | + Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase. | ||
PLN02608 | PLN02608 | 1.0e-118 | 6 | 224 | 219 | + L-ascorbate peroxidase | ||
PLN02364 | PLN02364 | 2.0e-123 | 1 | 225 | 226 | + L-ascorbate peroxidase 1 | ||
PLN02879 | PLN02879 | 3.0e-125 | 1 | 225 | 225 | + L-ascorbate peroxidase | ||
cd00691 | ascorbate_peroxidase | 7.0e-132 | 5 | 225 | 229 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004601 | peroxidase activity |
GO:0006979 | response to oxidative stress |
GO:0020037 | heme binding |
GO:0055114 | oxidation-reduction process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAB03844.1 | 0 | 1 | 225 | 1 | 226 | cytosolic ascorbate peroxidase [Vigna unguiculata] |
GenBank | AAC08576.1 | 0 | 1 | 225 | 1 | 226 | ascorbate peroxidase [Zantedeschia aethiopica] |
GenBank | ABX79340.1 | 0 | 1 | 224 | 1 | 224 | cytosolic ascorbate peroxidase [Vitis vinifera] |
EMBL | CBI32625.1 | 0 | 1 | 224 | 1 | 224 | unnamed protein product [Vitis vinifera] |
RefSeq | NP_001152249.1 | 0 | 1 | 225 | 1 | 226 | APx1 - Cytosolic Ascorbate Peroxidase [Zea mays] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1apx_D | 0 | 2 | 225 | 1 | 225 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 1apx_C | 0 | 2 | 225 | 1 | 225 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 1apx_B | 0 | 2 | 225 | 1 | 225 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 1apx_A | 0 | 2 | 225 | 1 | 225 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 2xj6_A | 0 | 2 | 225 | 1 | 225 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EE100162 | 226 | 1 | 225 | 0 |
HS065267 | 225 | 1 | 225 | 0 |
EE078064 | 226 | 1 | 225 | 0 |
EE105341 | 226 | 1 | 225 | 0 |
EE076324 | 226 | 1 | 225 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|