CAZyme Information

Basic Information
SpeciesCucumis sativus
Cazyme IDCucsa.063760.1
FamilyGH33
Protein PropertiesLength: 399 Molecular Weight: 44772.3 Isoelectric Point: 8.5653
ChromosomeChromosome/Scaffold: 00674 Start: 160602 End: 164105
DescriptionBNR/Asp-box repeat family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH33913831.2e-27
  ANSVPFNNCHASTIVEVDKDHYLVAYFGGTLEGAPDVKIWLQAFKNGSWHSPIVADEEPDIPMWNPVLFKLPSDELLLFYKVGQEVQKWSGCMKRSYDKG
  ITWTAREQLPPGILGPIKNKPILLENGVLLCGSSVESWNSWGAWMEVTSDSGRSWRKFGPIYMKNRSLSVIQPVPYQTANGNLRVLLRSFTGIDSICMSE
  SNDGGHNWSFAIPTNLPNPNSGIDGVKLRDGRLLLVYNTVSRGVLKVGLSLDDGDSWQDVMTLEDEPENEFSYPAVIEASDDSIHITYTYRRK
Full Sequence
Protein Sequence     Length: 399     Download
MRKLVGAVLI SFFLLSVFSI SSPGFGNTFI SKFNLLTPKF SSRIHRLYHH SHIFGPRVLV    60
RGHSNIVVRS LKMGKGSYVD GPLQEEFTFP ANSVPFNNCH ASTIVEVDKD HYLVAYFGGT    120
LEGAPDVKIW LQAFKNGSWH SPIVADEEPD IPMWNPVLFK LPSDELLLFY KVGQEVQKWS    180
GCMKRSYDKG ITWTAREQLP PGILGPIKNK PILLENGVLL CGSSVESWNS WGAWMEVTSD    240
SGRSWRKFGP IYMKNRSLSV IQPVPYQTAN GNLRVLLRSF TGIDSICMSE SNDGGHNWSF    300
AIPTNLPNPN SGIDGVKLRD GRLLLVYNTV SRGVLKVGLS LDDGDSWQDV MTLEDEPENE    360
FSYPAVIEAS DDSIHITYTY RRKQIKHVVF KLKVHEKH*                           420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00260Sialidase0.004183349204+
COG4692COG46921.0e-3395390348+
pfam13088BNR_24.0e-93110376282+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM61202.10833919317unknown [Arabidopsis thaliana]
RefSeqNP_001078763.10663915328BNR/Asp-box repeat family protein [Arabidopsis thaliana]
RefSeqNP_568864.20833919317BNR/Asp-box repeat family protein [Arabidopsis thaliana]
RefSeqXP_002263578.107839254368PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002531744.10733911319conserved hypothetical protein [Ricinus communis]
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
19
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EL689016287913770
ES9621062611043640
DV1373552681123790
EY114510258823390
DV1458162551093630
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_027_00263.5Aquca_027_00263.1Aquca_027_00263.2Aquca_027_00263.3Aquca_027_00263.4
Arabidopsis lyrata495867
Arabidopsis thalianaAT5G57700.1AT5G57700.2AT5G57700.3AT5G57700.4
Brachypodium distachyonBradi1g26287.2Bradi1g26287.4Bradi1g26287.1Bradi1g26287.3
Brassica rapaBra006806
Capsella rubellaCarubv10028058m
Citrus clementinaCiclev10008429m
Citrus sinensisorange1.1g020796m
Cucumis sativusCucsa.063760.7Cucsa.063760.5
Eucalyptus grandisEucgr.C02440.3Eucgr.C02440.2Eucgr.C02440.1
Fragaria vescamrna29636.1-v1.0-hybrid
Glycine maxGlyma13g01390.2Glyma13g01380.1Glyma17g07500.2Glyma17g07500.3Glyma17g07500.1
Gossypium raimondiiGorai.010G053100.8Gorai.010G053100.9Gorai.010G053100.6Gorai.012G095700.1Gorai.010G053100.5
Gorai.010G053100.4Gorai.010G053100.3Gorai.010G053100.2Gorai.010G053100.10Gorai.010G053100.1
Linum usitatissimumLus10008903
Malus domesticaMDP0000155009
Manihot esculentacassava4.1_011952m
Medicago truncatulaMedtr4g129200.1Medtr4g129180.1
Mimulus guttatusmgv1a018339m
Oryza sativaLOC_Os07g33220.1LOC_Os07g33224.1
Panicum virgatumPavirv00000088mPavirv00019697mPavirv00063023mPavirv00001202mPavirv00001203m
Pavirv00068158mPavirv00059537m
Physcomitrella patensPp1s96_140V6.2
Phaseolus vulgarisPhvul.003G150200.1Phvul.003G150000.2Phvul.003G150000.1Phvul.003G150000.4Phvul.003G150000.5
Phvul.003G150000.3Phvul.003G150000.6
Picea abiesMA_10435121g0010
Populus trichocarpaPotri.018G097100.1
Prunus persicappa020159m
Ricinus communis29749.m000140
Setaria italicaSi030500mSi030939mSi030026mSi029094m
Selaginella moellendorffii84263
Sorghum bicolorSb02g034675.1Sb02g034680.1
Thellungiella halophilaThhalv10013983m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny