CAZyme Information

Basic Information
SpeciesCucumis sativus
Cazyme IDCucsa.122250.2
FamilyGT66
Protein PropertiesLength: 723 Molecular Weight: 81283.4 Isoelectric Point: 9.3564
ChromosomeChromosome/Scaffold: 00999 Start: 539908 End: 544908
Descriptionstaurosporin and temperature sensitive 3-like b
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT66526710
  LIRVSILFLVYVLAFITRLFSVLRYESMIHEFDPYFNYRTTLFLTQKGFYEFWNWFDSESWYPLGRIIGGTLYPGLMVTAAIIYWGLRFLKFAVHIREVC
  VLTAPFFASNTTLVAYFFGKEIWDSGAGLVAAALIAICPGYISRSVAGSYDNEGVAIFALLLTFYLFVKAVNTGSLAWALASAFGYFYMVSAWGGYVFII
  NLIPLYVLVLLITGRYSMRLYVAYNCMYILGMLLAMQIRFVGFQHVQSGEHMAAMGVFFLIQVFYFLDWVKYMLSDTKLFQAFLKITVTSAVAVGTVALG
  VGTASGYISPWTGRFYSLLDPTYAKDHIPIIASVSEHQPTAWSSFMFDFHILLFLFPAGLYFCFKRLSDATIFIVMYGLTSMYFAGVMVRLILVATPAVC
  LISAIAVSATIKNLTQLLRAKPKVSQISSSKGVSNAKSFSKGSLDQSQPFQKNEAYSSPSIVLAARGAHGNRVIFDDYREAYFWLRQNTPQDAKIMSWWD
  YGYQITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEGEAYEIMRSLDVDYVLVVFGGVTGYSSDDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGA
  APKMLNCLMYKLSYYRFGEL
Full Sequence
Protein Sequence     Length: 723     Download
MGGKIEPVNG SVKSGSNNQT NSATITSNAK SGLLDSFSFK SFKLKTKQQE LLIRVSILFL    60
VYVLAFITRL FSVLRYESMI HEFDPYFNYR TTLFLTQKGF YEFWNWFDSE SWYPLGRIIG    120
GTLYPGLMVT AAIIYWGLRF LKFAVHIREV CVLTAPFFAS NTTLVAYFFG KEIWDSGAGL    180
VAAALIAICP GYISRSVAGS YDNEGVAIFA LLLTFYLFVK AVNTGSLAWA LASAFGYFYM    240
VSAWGGYVFI INLIPLYVLV LLITGRYSMR LYVAYNCMYI LGMLLAMQIR FVGFQHVQSG    300
EHMAAMGVFF LIQVFYFLDW VKYMLSDTKL FQAFLKITVT SAVAVGTVAL GVGTASGYIS    360
PWTGRFYSLL DPTYAKDHIP IIASVSEHQP TAWSSFMFDF HILLFLFPAG LYFCFKRLSD    420
ATIFIVMYGL TSMYFAGVMV RLILVATPAV CLISAIAVSA TIKNLTQLLR AKPKVSQISS    480
SKGVSNAKSF SKGSLDQSQP FQKNEAYSSP SIVLAARGAH GNRVIFDDYR EAYFWLRQNT    540
PQDAKIMSWW DYGYQITAMG NRTVIVDNNT WNNTHIATVG RAMSSYEGEA YEIMRSLDVD    600
YVLVVFGGVT GYSSDDINKF LWMVRIGGGV FPVIKEPDYL VNGEYRVDKG AAPKMLNCLM    660
YKLSYYRFGE LVTEYGKPPG FDRARGVEIG NKDIKLEHLE EAFTTSNWIV RIYRVKPPNN    720
RW* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR04154archaeo_STT35.0e-2255604613+
COG1287COG12872.0e-6650716723+
pfam02516STT34.0e-13852673657+
Gene Ontology
GO TermDescription
GO:0004576oligosaccharyl transferase activity
GO:0006486protein glycosylation
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_174675.2017211734STT3B (staurosporin and temperature sensitive 3-like b); oligosaccharyl transferase [Arabidopsis thaliana]
RefSeqXP_002269119.1057221737PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002318345.104872222721predicted protein [Populus trichocarpa]
RefSeqXP_002329687.103372224721predicted protein [Populus trichocarpa]
RefSeqXP_002514508.102666010669oligosaccharyl transferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2lgz_A050671628238A Chain A, Solution Structure Of Stt3p
PDB3vu0_C0.00035286446123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vu0_B0.00035286446123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vu0_A0.00035286446123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB2zai_D0.001510567261A Chain A, Crystal Structure Of The Soluble Domain Of Stt3 From P. Furiosus
Transmembrane Domains
StartEnd
5173
116138
145167
177199
206228
243265
272294
304321
342364
393415
422444
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT0360633473226430
GO8701293234247210
GO8695183263976970
GO869518146887012.1
GO869518156997132.1
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01458.1Aquca_001_00320.1
Arabidopsis lyrata891007488863
Arabidopsis thalianaAT1G34130.1AT5G19690.1
Brachypodium distachyonBradi5g26030.1Bradi2g49640.1Bradi2g19510.1
Brassica rapaBra028034Bra006514Bra002255Bra034441
Carica papayaevm.model.supercontig_467.1.248.439evm.model.supercontig_467.1.248.439evm.model.supercontig_40.47
Capsella rubellaCarubv10008402mCarubv10000271m
Chlamydomonas reinhardtiiCre07.g330100.t1.2g9581.t1
Citrus clementinaCiclev10019005mCiclev10019106mCiclev10007574mCiclev10007513mCiclev10007684m
Citrus sinensisorange1.1g004635morange1.1g005395morange1.1g004678morange1.1g003973m
Cucumis sativusCucsa.122250.1Cucsa.329260.1Cucsa.329260.2
Eucalyptus grandisEucgr.K02314.1Eucgr.C01008.1
Fragaria vescamrna09173.1-v1.0-hybridmrna11885.1-v1.0-hybrid
Glycine maxGlyma16g33881.1Glyma09g29470.1Glyma01g01270.1Glyma16g08410.1
Gossypium raimondiiGorai.013G004300.1Gorai.013G004300.2Gorai.011G219600.1Gorai.011G219600.4Gorai.011G219600.3
Gorai.011G219600.2Gorai.011G219600.5Gorai.013G229700.1Gorai.010G075800.1Gorai.010G075800.2
Gorai.010G075800.3
Linum usitatissimumLus10041985Lus10017990Lus10043241Lus10011124
Malus domesticaMDP0000299027MDP0000589608MDP0000158858MDP0000201702MDP0000300736
Manihot esculentacassava4.1_002347mcassava4.1_021540m
Medicago truncatulaMedtr6g077750.1Medtr6g077750.2Medtr1g114250.1
Mimulus guttatusmgv1a001976mmgv1a001650m
Oryza sativaLOC_Os04g57890.1LOC_Os05g44360.1LOC_Os05g44360.2
Panicum virgatumPavirv00017930mPavirv00007453mPavirv00022940mPavirv00024588mPavirv00056880m
Pavirv00065583m
Physcomitrella patensPp1s98_21V6.1Pp1s404_37V6.1Pp1s404_38V6.1
Phaseolus vulgarisPhvul.004G139400.1Phvul.004G170000.1
Picea abiesMA_174842g0010MA_10216317g0010MA_5501292g0010MA_10436134g0010
Populus trichocarpaPotri.012G036300.1Potri.015G028300.1Potri.015G028300.2Potri.018G086000.2Potri.018G086000.1
Potri.006G163600.1
Prunus persicappa001886mppa001464m
Ricinus communis30189.m00167429912.m005461
Setaria italicaSi021341mSi000402mSi021271mSi021321m
Selaginella moellendorffii110405118919
Sorghum bicolorSb06g032800.1Sb09g025920.1Sb03g034385.1
Thellungiella halophilaThhalv10006908mThhalv10012742m
Vitis viniferaGSVIVT01015322001GSVIVT01029339001
Volvox carteriVocar20013212mVocar20003562m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)