y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCucumis sativus
Cazyme IDCucsa.123460.1
FamilyCE10
Protein PropertiesLength: 643 Molecular Weight: 71676.5 Isoelectric Point: 4.9889
ChromosomeChromosome/Scaffold: 01000 Start: 687562 End: 693668
Descriptionalpha/beta-Hydrolases superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE104426418.7e-23
  KPPLLLESHGGPTDEARGILNLRIQYWTSRGWAFVNVNYGGSSGYGRAYRERLLRKWGIVDINDCCSCARYLVDSGLVDAERLCIDGESAGGYTTLAALA
  FRDTFKAGASLYGISDLSMLKAETHKFESHYLDNLVGDEIDFYERSPINFVEKFSCPLILFQGLDDKVVPPIQARKIYQALKEKGLHVALIEYEGEQHGF
Full Sequence
Protein Sequence     Length: 643     Download
MASSVSSSVT NQLEKITAPY GSWKSPITAD VVSGASKQIG GAAVDGSGRL IWLESRPSES    60
GREVLVKEPE KLGGENIDVT PKEFSVRTTA QEYGGGAFMV SGDTVVFSNF EDQRLYKQSV    120
KPHDSAPRPL TPDYGGPLVS YADGVFDLCF NRYIAVREDR RISSSSPTTT IVSIRLEGKT    180
IEDPEVLVEG SDFYGFPRVD PKGKRIAWIQ WHHPNMSWDK SELWVGYFSD SGEINKHVCV    240
AGREPELVES PTEPKWSSEG ELFFVTDRKN GFWNLYKWLE ADNEVSPIYS LNAEFSRPVW    300
VFGINSYGFL PGNEGENYIL CSYRQHGRSY LGVLGDGQSS PSLLDIPFSD IDNITIGNHC    360
FYVEGASAFH PPSIAKVTLK DKSLKVDEFA IIWSSSPDIL TYKSYFSTPK LIEFATEVPG    420
EKAYAFFYPP FSPIYHSSGD EKPPLLLESH GGPTDEARGI LNLRIQYWTS RGWAFVNVNY    480
GGSSGYGRAY RERLLRKWGI VDINDCCSCA RYLVDSGLVD AERLCIDGES AGGYTTLAAL    540
AFRDTFKAGA SLYGISDLSM LKAETHKFES HYLDNLVGDE IDFYERSPIN FVEKFSCPLI    600
LFQGLDDKVV PPIQARKIYQ ALKEKGLHVA LIEYEGEQHG FRK                      660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0657Aes8.0e-7437641233+
PRK10566PRK105661.0e-7517631123+
pfam07859Abhydrolase_39.0e-8503641162+
pfam00326Peptidase_S91.0e-38461643188+
COG1506DAP23.0e-52186643467+
Gene Ontology
GO TermDescription
GO:0006508proteolysis
GO:0008236serine-type peptidase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_198470.301264364692serine-type peptidase [Arabidopsis thaliana]
RefSeqXP_002284254.101464311640PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002284264.1016431638PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002302446.1016431635predicted protein [Populus trichocarpa]
RefSeqXP_002510270.10164351694acylamino-acid-releasing enzyme, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3azo_B0176434629A Chain A, Crystal Structure Of Puromycin Hydrolase
PDB3azo_A0176434629A Chain A, Crystal Structure Of Puromycin Hydrolase
PDB3azq_B0176434629A Chain A, Crystal Structure Of Puromycin Hydrolase
PDB3azq_A0176434629A Chain A, Crystal Structure Of Puromycin Hydrolase
PDB3azp_B0176434629A Chain A, Crystal Structure Of Puromycin Hydrolase S511a Mutant
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7802163852606430
HO780216861792640
GO8785023422205610
DV7111722963486430
DV7110392963486430
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00583.4Aquca_017_00583.3Aquca_017_00583.2Aquca_017_00583.1Aquca_015_00163.1
Arabidopsis lyrata915409859721
Arabidopsis thalianaAT4G14570.1AT5G36210.1
Brachypodium distachyonBradi3g26780.4Bradi3g26780.3Bradi3g26780.2Bradi3g26787.1Bradi1g45890.1
Brassica rapaBra039731Bra036867Bra037063Bra030822
Capsella rubellaCarubv10006608mCarubv10013057mCarubv10012695mCarubv10013077mCarubv10004231m
Chlamydomonas reinhardtiiCre05.g241650.t1.3Cre10.g423300.t1.1
Citrus clementinaCiclev10004377mCiclev10004325mCiclev10003676m
Citrus sinensisorange1.1g005093morange1.1g004149morange1.1g004141morange1.1g003363morange1.1g004816m
orange1.1g004757morange1.1g004756morange1.1g004735m
Cucumis sativusCucsa.386660.1Cucsa.123480.1
Eucalyptus grandisEucgr.H00222.1Eucgr.H00221.1Eucgr.F00026.5Eucgr.F00026.4Eucgr.F00026.3
Eucgr.F00026.2Eucgr.F00026.1Eucgr.F00028.1Eucgr.F00027.2Eucgr.F00027.1
Eucgr.L02208.1Eucgr.F00027.3Eucgr.F00025.1
Fragaria vescamrna29072.1-v1.0-hybridmrna32579.1-v1.0-hybridmrna09045.1-v1.0-hybridmrna09044.1-v1.0-hybrid
Glycine maxGlyma10g00350.1Glyma10g00320.1Glyma08g42730.1Glyma18g11480.3Glyma18g11480.2
Glyma18g11480.4
Gossypium raimondiiGorai.006G245500.5Gorai.006G245500.4Gorai.006G245500.3Gorai.006G245500.1Gorai.010G016900.1
Linum usitatissimumLus10039405Lus10015363Lus10032765Lus10021758
Malus domesticaMDP0000211874MDP0000304250MDP0000251803
Manihot esculentacassava4.1_002075mcassava4.1_031105mcassava4.1_005468m
Medicago truncatulaAC233668_48.1Medtr5g042400.2Medtr5g042400.1Medtr5g042410.1Medtr3g051310.1
Mimulus guttatusmgv1a001402mmgv1a001397mmgv1a002403m
Oryza sativaLOC_Os10g28020.3LOC_Os10g28020.1LOC_Os10g28020.2LOC_Os10g28030.2LOC_Os10g28030.1
LOC_Os06g11180.1
Panicum virgatumPavirv00008779mPavirv00061808mPavirv00015591mPavirv00045661mPavirv00003810m
Pavirv00003809m
Physcomitrella patensPp1s619_3V6.1Pp1s97_68V6.1Pp1s108_134V6.1Pp1s9_317V6.2Pp1s9_317V6.1
Pp1s139_36V6.2Pp1s139_36V6.1
Phaseolus vulgarisPhvul.007G279900.1Phvul.007G280000.1Phvul.006G042600.1Phvul.006G042700.1
Populus trichocarpaPotri.008G160400.1Potri.002G128700.9Potri.002G128700.8Potri.002G128700.7Potri.002G128700.6
Potri.002G128700.5Potri.002G128700.4Potri.002G128700.3Potri.002G128700.2Potri.002G128700.10
Potri.002G128700.1
Prunus persicappa001729mppa002365m
Ricinus communis29844.m00318230170.m01392428323.m000042
Setaria italicaSi034264mSi034356mSi006001mSi005937mSi005954m
Selaginella moellendorffii16830378836
Sorghum bicolorSb01g021970.4Sb01g021970.2Sb01g021970.1Sb01g021970.5Sb01g021960.1
Sb01g021970.3Sb10g007280.1Sb10g007270.1
Thellungiella halophilaThhalv10024477mThhalv10003712m
Vitis viniferaGSVIVT01018091001GSVIVT01009564001GSVIVT01009565001
Volvox carteriVocar20006950m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)