CAZyme Information

Basic Information
SpeciesCucumis sativus
Cazyme IDCucsa.124250.1
FamilyAA2
Protein PropertiesLength: 259 Molecular Weight: 28884 Isoelectric Point: 5.1678
ChromosomeChromosome/Scaffold: 01001 Start: 227522 End: 228766
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA222374.7e-38
  VKSCDASLLLEMKNEEGVVISEMKSPRSFGIRNLKYVNKIKQVIENECPNTVSCADIMALAARDAIVLLGGLEMEMKTGRRDSKESYGEMVEEFIPNHND
  SLSLVLSRFQDIGIDAEATVALLGAHSIGRVHCVNLVNRLYPTVDPTLDPNHALYLQKRCPNPDPDPKAVQYARNDLESPMVVDNNYYRNVLDNKALLLV
  DQQLGSSPITLPYVQQMASNNTYFLAQFARALLLLS
Full Sequence
Protein Sequence     Length: 259     Download
MVKSCDASLL LEMKNEEGVV ISEMKSPRSF GIRNLKYVNK IKQVIENECP NTVSCADIMA    60
LAARDAIVLL GGLEMEMKTG RRDSKESYGE MVEEFIPNHN DSLSLVLSRF QDIGIDAEAT    120
VALLGAHSIG RVHCVNLVNR LYPTVDPTLD PNHALYLQKR CPNPDPDPKA VQYARNDLES    180
PMVVDNNYYR NVLDNKALLL VDQQLGSSPI TLPYVQQMAS NNTYFLAQFA RALLLLSDNN    240
PLTDDQGEIR KDCRRVNK* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00141peroxidase0.00119022132+
cd00314plant_peroxidase_like3.0e-165224243+
PLN03030PLN030301.0e-322257268+
pfam00141peroxidase4.0e-351141142+
cd00693secretory_peroxidase7.0e-972256260+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN97181.10125776329peroxidase [Populus trichocarpa]
RefSeqNP_001118461.10125742296peroxidase 21 (PER21) (P21) (PRXR5) [Arabidopsis thaliana]
RefSeqNP_181250.10125773327peroxidase 21 (PER21) (P21) (PRXR5) [Arabidopsis thaliana]
RefSeqXP_002275288.10125774327PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002326343.10125776329predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1qo4_A0125746304A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins
PDB1pa2_A0125746304A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB4a5g_B1.4013e-45125747305A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB4a5g_A1.4013e-45125747305A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB1sch_B2.94273e-44125745294A Chain A, Peanut Peroxidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
AM716272239212590
BG64743125262570
FF40090924312430
EV57080725812570
EV57080825812570
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_001_00478.1Aquca_005_00071.2Aquca_005_00071.1Aquca_016_00057.1Aquca_005_00071.3
Arabidopsis lyrata898035492673345443
Arabidopsis thalianaAT3G17070.1AT2G37130.2AT2G37130.1AT4G21960.1
Brassica rapaBra022195Bra017206Bra023099Bra013576
Carica papayaevm.model.supercontig_152.14evm.model.supercontig_525.1
Capsella rubellaCarubv10014103mCarubv10023623mCarubv10005223m
Citrus clementinaCiclev10026124mCiclev10026035mCiclev10012170mCiclev10015870mCiclev10016494m
Citrus sinensisorange1.1g045164morange1.1g020143morange1.1g020084morange1.1g021519morange1.1g019854m
orange1.1g019129morange1.1g021841morange1.1g026488morange1.1g020712morange1.1g021207m
orange1.1g028028morange1.1g036121m
Cucumis sativusCucsa.307020.2Cucsa.307020.1Cucsa.085830.1Cucsa.307020.3
Eucalyptus grandisEucgr.E03999.1Eucgr.E04056.1Eucgr.D01322.1Eucgr.A01166.1
Fragaria vescamrna05105.1-v1.0-hybridmrna25836.1-v1.0-hybridmrna19619.1-v1.0-hybridmrna09649.1-v1.0-hybrid
Glycine maxGlyma07g39290.1Glyma17g01440.2Glyma13g20170.1Glyma10g05800.1Glyma17g01720.1
Glyma07g39020.1Glyma04g10761.1
Gossypium raimondiiGorai.011G200600.1Gorai.006G168000.3Gorai.006G168000.1Gorai.009G419100.1Gorai.006G168000.2
Gorai.009G178400.1
Linum usitatissimumLus10015074Lus10006778Lus10020045
Malus domesticaMDP0000292744MDP0000124622MDP0000303101MDP0000545323MDP0000192235
Manihot esculentacassava4.1_011604mcassava4.1_012064mcassava4.1_031903m
Medicago truncatulaMedtr6g045330.1Medtr4g132490.1Medtr4g132110.2Medtr1g066380.1Medtr4g132110.1
Medtr1g066380.2Medtr4g132110.3
Mimulus guttatusmgv1a009704mmgv1a009981mmgv1a010406mmgv1a007622mmgv1a010067m
mgv1a019681mmgv1a025816mmgv1a026804m
Oryza sativaLOC_Os07g49360.1LOC_Os05g14260.1
Panicum virgatumPavirv00050429mPavirv00010935m
Physcomitrella patensPp1s8_186V6.1Pp1s44_71V6.1Pp1s10_225V6.1Pp1s62_126V6.1Pp1s16_148V6.1
Pp1s104_177V6.3Pp1s104_177V6.2Pp1s104_177V6.1Pp1s433_15V6.2Pp1s433_15V6.1
Phaseolus vulgarisPhvul.007G107400.1Phvul.003G078600.1
Picea abiesMA_83406g0010MA_530154g0010MA_10432809g0020MA_10427936g0010MA_6481365g0010
MA_10432809g0010
Populus trichocarpaPotri.004G015300.2Potri.004G015300.1Potri.006G129900.1Potri.004G006400.1
Prunus persicappa008634mppa022386mppa008503m
Ricinus communis29842.m00359530078.m002355
Setaria italicaSi022597m
Selaginella moellendorffii10502977725116945140930107369
1370671793877725976459403456
11598223276377662
Sorghum bicolorSb09g007950.1Sb09g018150.1
Thellungiella halophilaThhalv10021081mThhalv10016921mThhalv10025680m
Vitis viniferaGSVIVT01034984001GSVIVT01025650001GSVIVT01012727001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)