| Basic Information | |
|---|---|
| Species | Cucumis sativus |
| Cazyme ID | Cucsa.142770.1 |
| Family | GH17 |
| Protein Properties | Length: 137 Molecular Weight: 15055.6 Isoelectric Point: 6.3386 |
| Chromosome | Chromosome/Scaffold: 01079 Start: 985654 End: 986642 |
| Description | beta-1,3-glucanase 5 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 35 | 136 | 5.5e-22 |
| FSNSFVAHISKSLLAYQADVGDVAIAIGETGWPTQGNYGAGPSLALTYNLNFNNPITSGKGTPMKPNVYIEGFIRSLFNENEKPEGESQFYGMFHVDSTP IY | |||
| Full Sequence |
|---|
| Protein Sequence Length: 137 Download |
| MDPKVTTSHH HGRWCNSAKN TIFVAFDSVN QISIFSNSFV AHISKSLLAY QADVGDVAIA 60 IGETGWPTQG NYGAGPSLAL TYNLNFNNPI TSGKGTPMKP NVYIEGFIRS LFNENEKPEG 120 ESQFYGMFHV DSTPIYX |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00332 | Glyco_hydro_17 | 3.0e-16 | 55 | 136 | 83 | + Glycosyl hydrolases family 17. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAM62473.1 | 2e-16 | 35 | 136 | 238 | 342 | beta-1,3-glucanase bg4 [Arabidopsis thaliana] |
| GenBank | AAO41887.1 | 9e-16 | 54 | 136 | 2 | 86 | putative glycosyl hydrolase family 17 (beta-1,3-glucanase bg4) [Arabidopsis thaliana] |
| GenBank | ABN05913.1 | 0.000000000000003 | 35 | 136 | 230 | 333 | Glycoside hydrolase, family 17 [Medicago truncatula] |
| RefSeq | NP_197533.1 | 0.000000000000003 | 35 | 136 | 238 | 342 | BETAG4; catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana] |
| RefSeq | NP_197534.1 | 6e-16 | 35 | 136 | 247 | 351 | BG5 (beta-1,3-glucanase 5); glucan 1,3-beta-glucosidase/ hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3ur8_B | 0.00000000001 | 35 | 136 | 207 | 310 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| PDB | 3ur8_A | 0.00000000001 | 35 | 136 | 207 | 310 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| PDB | 3ur7_B | 0.00000000001 | 35 | 136 | 207 | 310 | A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase |
| PDB | 3ur7_A | 0.00000000001 | 35 | 136 | 207 | 310 | A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase |
| PDB | 4gzj_A | 0.00000000008 | 35 | 136 | 207 | 310 | A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| ES929792 | 105 | 35 | 136 | 1e-17 |
| GO568044 | 104 | 34 | 136 | 1e-17 |
| DR372221 | 105 | 35 | 136 | 8e-17 |
| GO559253 | 104 | 35 | 136 | 3e-16 |
| AM726542 | 85 | 55 | 136 | 0.000000000000002 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Brassica rapa | Bra003668 | ||||
| Carica papaya | evm.model.supercontig_49.127 | evm.model.supercontig_49.128.179.264 | evm.model.supercontig_49.128.179.264 | ||
| Cucumis sativus | Cucsa.141670.1 | ||||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |