y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCucumis sativus
Cazyme IDCucsa.155280.1
FamilyAA7
Protein PropertiesLength: 482 Molecular Weight: 53955.7 Isoelectric Point: 7.196
ChromosomeChromosome/Scaffold: 01136 Start: 72608 End: 75407
Descriptioncytokinin oxidase 4
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA7162197.4e-26
  YGLMVQHNPYAVFFPVTGHDVAGLIRFMYMLPVPLHIAARGQGHCVRGQALVDQNGVVVNMTSLGGLRQKTSRIVVTTTSPLGPYADVGAEQLWIDVLHA
  TTQKGLSPVSWVDYLHITVGGTLSNAGISGQTFRFGPQINNVYELDVITGKGESLTCSPTNNPELFYSLLGGLGQFGIITRARIALAPTPTRVKWVRMLY
  TNFS
Full Sequence
Protein Sequence     Length: 482     Download
KLKYDLQTIS LASKDYGLMV QHNPYAVFFP VTGHDVAGLI RFMYMLPVPL HIAARGQGHC    60
VRGQALVDQN GVVVNMTSLG GLRQKTSRIV VTTTSPLGPY ADVGAEQLWI DVLHATTQKG    120
LSPVSWVDYL HITVGGTLSN AGISGQTFRF GPQINNVYEL DVITGKGESL TCSPTNNPEL    180
FYSLLGGLGQ FGIITRARIA LAPTPTRVKW VRMLYTNFSS FTSDQESLIS RDPSNAPDYL    240
EGLLLLQLNA GDKSSFYPLP DQPKISSLVS QYGIVYVLEL VKYYDQHSSS SVDQVRIGDF    300
VGGLKFEAGM KFVKDASYEE FLDRVHTDEV ALRALGLWEV PHPWINLFVP KSRIADFDSG    360
VFRGIIQKRN LTSGVFLFYP MFKNKWDERT SAVIPDEEVF YAAGFLLSSG FKDWETVDGH    420
GRDILKFCEE AGIEVKQYLP HFETEKDWIN HFGRKWSVFR QRKSMFDPKH LLSPGQKIFN    480
V*                                                                   540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR01679bact_FAD_ox1.0e-624214196+
pfam01565FAD_binding_44.0e-1524173151+
COG0277GlcD6.0e-2020476473+
pfam09265Cytokin-bind4.0e-120205479282+
PLN02441PLN0244101480485+
Gene Ontology
GO TermDescription
GO:0008762UDP-N-acetylmuramate dehydrogenase activity
GO:0009690cytokinin metabolic process
GO:0016491oxidoreductase activity
GO:0019139cytokinin dehydrogenase activity
GO:0050660flavin adenine dinucleotide binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACM79256.10148045524cytokinin oxidase/dehydrogenase [Gossypium hirsutum]
EMBLCAN80714.10148045520hypothetical protein [Vitis vinifera]
RefSeqXP_002264539.10148045520PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002308300.10248047527cytokinin oxidase [Populus trichocarpa]
RefSeqXP_002514119.10148046529gulonolactone oxidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3s1e_A0148028516A Chain A, Pro427gln Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenine
PDB3s1c_A0148028516A Chain A, Pro427gln Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenine
PDB3dq0_A0148028516A Chain A, Pro427gln Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenine
PDB3c0p_A0148028516A Chain A, Pro427gln Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenine
PDB3bw7_A0148028516A Chain A, Pro427gln Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenine
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO781924481104790
CO1216102751334020
DV1356042282534800
ES8377142921214090
CO11791224212390
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01436.1Aquca_002_01436.2Aquca_014_00736.1Aquca_007_00318.1Aquca_009_00356.1
Aquca_010_00588.1
Arabidopsis lyrata483228489034867825476695857642
918856480522
Arabidopsis thalianaAT2G41510.1AT5G21482.1AT3G63440.1AT1G75450.1AT1G75450.2
AT4G29740.2AT4G29740.1AT5G56970.1AT2G19500.1
Brachypodium distachyonBradi3g29130.2Bradi3g29130.1Bradi2g27170.1Bradi2g60456.1Bradi2g05580.1
Bradi3g08230.1Bradi2g06030.1Bradi1g37470.1Bradi3g08220.1Bradi3g37690.1
Bradi2g51530.1
Brassica rapaBra016928Bra020157Bra002371Bra007743Bra000229
Bra004626Bra015842Bra040677Bra002777Bra036719
Bra035640Bra024135
Carica papayaevm.model.supercontig_182.26evm.model.supercontig_2087.1evm.model.supercontig_126.29
Capsella rubellaCarubv10022823mCarubv10018610mCarubv10000702mCarubv10026233mCarubv10013466m
Carubv10023000mCarubv10020114m
Chlamydomonas reinhardtiig9859.t1
Citrus clementinaCiclev10006491mCiclev10008441mCiclev10007999mCiclev10000709mCiclev10007992m
Ciclev10031210m
Citrus sinensisorange1.1g009956morange1.1g016403morange1.1g008291morange1.1g042782morange1.1g009793m
orange1.1g022399m
Cucumis sativusCucsa.018150.1Cucsa.231890.1Cucsa.155270.1Cucsa.299790.2Cucsa.299790.1
Cucsa.166070.1Cucsa.117040.1
Eucalyptus grandisEucgr.F01857.1Eucgr.G03270.1Eucgr.K01574.1Eucgr.C03157.1Eucgr.C00881.1
Eucgr.H03195.1Eucgr.C00883.1Eucgr.H03393.1Eucgr.H03190.1Eucgr.H03197.1
Fragaria vescamrna21961.1-v1.0-hybridmrna15204.1-v1.0-hybridmrna30442.1-v1.0-hybridmrna14452.1-v1.0-hybridmrna15382.1-v1.0-hybrid
mrna30654.1-v1.0-hybridmrna12649.1-v1.0-hybridmrna12648.1-v1.0-hybrid
Glycine maxGlyma09g07190.4Glyma09g07190.3Glyma09g07190.2Glyma09g07190.1Glyma14g11280.1
Glyma03g28910.2Glyma12g01390.2Glyma12g01390.1Glyma19g31620.1Glyma09g35950.1
Glyma13g16430.1Glyma11g20860.1Glyma17g06220.1Glyma17g06230.1Glyma13g16420.2
Glyma09g07360.1Glyma06g03180.1Glyma15g18560.1Glyma04g03130.1Glyma06g03180.2
Glyma17g34330.1
Gossypium raimondiiGorai.011G295400.1Gorai.012G081000.1Gorai.009G198300.4Gorai.009G198300.3Gorai.009G198300.2
Gorai.009G198300.1Gorai.013G014800.1Gorai.010G083400.1Gorai.006G134800.1Gorai.004G286300.1
Gorai.009G040700.4Gorai.009G040700.3Gorai.009G040700.2Gorai.009G040700.1Gorai.010G096700.3
Gorai.010G096700.2Gorai.010G096700.1Gorai.013G227400.1Gorai.001G012300.1Gorai.010G007500.1
Gorai.002G126300.1Gorai.013G221000.1
Linum usitatissimumLus10035433Lus10031046Lus10039574Lus10005317Lus10026471
Lus10018039Lus10016363Lus10024289Lus10003845Lus10027611
Lus10031765Lus10031188Lus10031200
Malus domesticaMDP0000223673MDP0000318353MDP0000293966MDP0000256199MDP0000250917
MDP0000238100MDP0000271354MDP0000312902MDP0000213431MDP0000211550
MDP0000279125
Manihot esculentacassava4.1_033022mcassava4.1_029100mcassava4.1_004923mcassava4.1_005650mcassava4.1_008801m
cassava4.1_005737mcassava4.1_033151m
Medicago truncatulaMedtr1g015410.1Medtr7g090920.1Medtr3g036100.1Medtr4g044110.1Medtr2g039410.1
Mimulus guttatusmgv1a004484mmgv1a022053mmgv1a004444mmgv1a004144mmgv1a004294m
Oryza sativaLOC_Os08g35860.1LOC_Os05g31040.1LOC_Os10g34230.1LOC_Os01g71310.1LOC_Os04g44230.1
LOC_Os01g09260.1LOC_Os02g12780.1LOC_Os01g10110.1LOC_Os06g37500.1LOC_Os01g56810.1
Panicum virgatumPavirv00052903mPavirv00063358mPavirv00060424mPavirv00044659mPavirv00018118m
Pavirv00028994mPavirv00031945mPavirv00035115mPavirv00059528mPavirv00068235m
Pavirv00015211mPavirv00010010mPavirv00027542mPavirv00001793m
Physcomitrella patensPp1s403_31V6.1Pp1s595_6V6.1Pp1s222_49V6.1Pp1s152_115V6.1
Phaseolus vulgarisPhvul.001G038800.1Phvul.001G128800.1Phvul.011G014000.1Phvul.005G034000.1Phvul.009G060200.1
Phvul.003G136400.1Phvul.003G136500.1Phvul.009G081800.1Phvul.009G231700.1Phvul.009G231800.1
Picea abiesMA_173695g0010MA_31778g0010MA_113618g0010MA_42031g0010MA_17212g0010
MA_138486g0010MA_32541g0010MA_23320g0010MA_10433485g0010MA_5215129g0010
MA_197101g0010
Populus trichocarpaPotri.016G044100.1Potri.006G047900.1Potri.001G020900.1Potri.003G203600.1Potri.005G232300.1
Potri.002G030500.1Potri.006G152500.1Potri.006G221000.1Potri.007G066100.1
Prunus persicappa024442mppa004120mppa003895mppb021417mppa004276m
ppa021859m
Ricinus communis29912.m00533430131.m00725529614.m00004030170.m01410329739.m003615
30169.m006344
Setaria italicaSi001018mSi021761mSi035175mSi000960mSi012051m
Si019278mSi008391mSi013710mSi013569m
Selaginella moellendorffii17472198722
Sorghum bicolorSb07g022530.1Sb09g018640.1Sb03g045410.1Sb01g019000.1Sb03g003280.1
Sb03g002810.1Sb04g007740.1Sb04g007730.1Sb06g022930.1Sb10g022590.1
Thellungiella halophilaThhalv10013259mThhalv10016470mThhalv10005878mThhalv10018378mThhalv10013271m
Thhalv10024918mThhalv10023158m
Vitis viniferaGSVIVT01001461001GSVIVT01005041001GSVIVT01009786001GSVIVT01015194001GSVIVT01028599001
GSVIVT01028610001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)