y
Basic Information | |
---|---|
Species | Cucumis sativus |
Cazyme ID | Cucsa.188640.1 |
Family | CE11 |
Protein Properties | Length: 139 Molecular Weight: 15221.5 Isoelectric Point: 7.2927 |
Chromosome | Chromosome/Scaffold: 01298 Start: 42340 End: 42868 |
Description | UDP-3-O-acyl N-acetylglycosamine deacetylase family protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CE11 | 35 | 125 | 8.6e-32 |
QQTLAGCLELSGISLHSGKVAKVKLCPEFAGRGRYFDFKSNFIPASIDYAEDSPLCTTLSKDGFKIRTVEHLLSAMEAMGVDNCRIVITNE |
Full Sequence |
---|
Protein Sequence Length: 139 Download |
MLVPTAFNAL KSSRSISWSP VFSLSLSIEM TGRLQQTLAG CLELSGISLH SGKVAKVKLC 60 PEFAGRGRYF DFKSNFIPAS IDYAEDSPLC TTLSKDGFKI RTVEHLLSAM EAMGVDNCRI 120 VITNEDAKDS EVEVRVTRA 180 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PRK13188 | PRK13188 | 2.0e-18 | 35 | 120 | 92 | + bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed | ||
TIGR00325 | lpxC | 2.0e-20 | 35 | 126 | 96 | + UDP-3-0-acyl N-acetylglucosamine deacetylase. UDP-3-O-(R-3-hydroxymyristoyl)-GlcNAc deacetylase from E. coli , LpxC, was previously designated EnvA. This enzyme is involved in lipid-A precursor biosynthesis. It is essential for cell viability [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]. | ||
pfam03331 | LpxC | 2.0e-21 | 35 | 126 | 96 | + UDP-3-O-acyl N-acetylglycosamine deacetylase. The enzymes in this family catalyze the second step in the biosynthetic pathway for lipid A. | ||
COG0774 | LpxC | 1.0e-22 | 33 | 122 | 95 | + UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell envelope biogenesis, outer membrane] | ||
PRK13186 | lpxC | 1.0e-29 | 35 | 125 | 95 | + UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase; Reviewed |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0008759 | UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase activity |
GO:0009245 | lipid A biosynthetic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CBI26831.1 | 0 | 1 | 136 | 1 | 126 | unnamed protein product [Vitis vinifera] |
RefSeq | NP_001117351.1 | 1.4013e-45 | 1 | 136 | 1 | 140 | UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Arabidopsis thaliana] |
RefSeq | NP_173874.2 | 9.80909e-45 | 1 | 136 | 1 | 140 | UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Arabidopsis thaliana] |
RefSeq | NP_173884.5 | 2.94273e-44 | 1 | 136 | 44 | 183 | UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Arabidopsis thaliana] |
RefSeq | XP_002281269.1 | 0 | 1 | 136 | 1 | 126 | PREDICTED: hypothetical protein [Vitis vinifera] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 4fw7_D | 0.000000002 | 35 | 120 | 7 | 96 | A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine |
PDB | 4fw7_C | 0.000000002 | 35 | 120 | 7 | 96 | A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine |
PDB | 4fw7_B | 0.000000002 | 35 | 120 | 7 | 96 | A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine |
PDB | 4fw7_A | 0.000000002 | 35 | 120 | 7 | 96 | A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine |
PDB | 4fw6_D | 0.000000002 | 35 | 120 | 7 | 96 | A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
GW831538 | 134 | 3 | 136 | 0 |
BE053971 | 136 | 1 | 136 | 0 |
BQ405531 | 133 | 4 | 136 | 0 |
GW932242 | 132 | 5 | 136 | 0 |
CU585894 | 131 | 6 | 136 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|