| Basic Information | |
|---|---|
| Species | Cucumis sativus |
| Cazyme ID | Cucsa.188650.1 |
| Family | CE11 |
| Protein Properties | Length: 105 Molecular Weight: 11885.6 Isoelectric Point: 4.2942 |
| Chromosome | Chromosome/Scaffold: 01298 Start: 48336 End: 49095 |
| Description | UDP-3-O-acyl N-acetylglycosamine deacetylase family protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CE11 | 1 | 104 | 2.4e-28 |
| VPIFDGSAGKWVDAIEEIGLKLAIDQCGNFCEKMAPHVNQPVHVWRNDCFLIAFPATEVRITYGIDFPQVPEIGCQWFFTAPLDNKFYAEQIAPSRTFCI YEEV | |||
| Full Sequence |
|---|
| Protein Sequence Length: 105 Download |
| VPIFDGSAGK WVDAIEEIGL KLAIDQCGNF CEKMAPHVNQ PVHVWRNDCF LIAFPATEVR 60 ITYGIDFPQV PEIGCQWFFT APLDNKFYAE QIAPSRTFCI YEEVG |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PRK13188 | PRK13188 | 4.0e-11 | 2 | 104 | 110 | + bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed | ||
| TIGR00325 | lpxC | 6.0e-14 | 1 | 104 | 104 | + UDP-3-0-acyl N-acetylglucosamine deacetylase. UDP-3-O-(R-3-hydroxymyristoyl)-GlcNAc deacetylase from E. coli , LpxC, was previously designated EnvA. This enzyme is involved in lipid-A precursor biosynthesis. It is essential for cell viability [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]. | ||
| COG0774 | LpxC | 4.0e-17 | 1 | 104 | 105 | + UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell envelope biogenesis, outer membrane] | ||
| PRK13186 | lpxC | 1.0e-20 | 1 | 104 | 108 | + UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase; Reviewed | ||
| pfam03331 | LpxC | 4.0e-23 | 1 | 104 | 104 | + UDP-3-O-acyl N-acetylglycosamine deacetylase. The enzymes in this family catalyze the second step in the biosynthetic pathway for lipid A. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0008759 | UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase activity |
| GO:0009245 | lipid A biosynthetic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CAN61403.1 | 8.40779e-45 | 1 | 104 | 146 | 249 | hypothetical protein [Vitis vinifera] |
| EMBL | CBI26831.1 | 4.06377e-44 | 1 | 104 | 124 | 227 | unnamed protein product [Vitis vinifera] |
| RefSeq | NP_173874.2 | 2e-38 | 1 | 104 | 138 | 241 | UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Arabidopsis thaliana] |
| RefSeq | XP_002281269.1 | 1.4013e-45 | 1 | 104 | 124 | 227 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002315856.1 | 9.99995e-41 | 1 | 104 | 108 | 210 | predicted protein [Populus trichocarpa] |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| CK277774 | 104 | 1 | 104 | 1.4013e-45 |
| FG933373 | 104 | 1 | 104 | 5.60519e-45 |
| FC462005 | 104 | 1 | 104 | 5.60519e-45 |
| FG823614 | 104 | 1 | 104 | 9.80909e-45 |
| BG128806 | 104 | 1 | 104 | 9.80909e-45 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |