y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCucumis sativus
Cazyme IDCucsa.237200.1
FamilyGH116
Protein PropertiesLength: 945 Molecular Weight: 104575 Isoelectric Point: 6.2468
ChromosomeChromosome/Scaffold: 02023 Start: 185040 End: 196035
DescriptionBeta-glucosidase, GBA2 type family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1165198790
  NLLLVEGSQYLMWNTYDVHFYSSFALIMLFPKLELSIQRDFAAAVLMHDPRKAKTMCDGNWVPRKVLGAVPHDIGFNDPWLEVNAYNLLNVSRWKDLGSK
  FVLQVYRDVVATGDKNFAKSVWPSVYVALAFMEQFDKDKDGMIENEGFPDQTYDTWTVKGVSAYCGGLWVAALQAASALASEVDDEAAAHYFWIKYQKAR
  SVYETLWNGSYFNYDNSKGPWSSSIQADQLAGQWYARACGLCPIADEEKIRVALEKIYNFNVMKVKGGTRGAVNGMFPDGSVDKSILQPKEIWAGVTYSV
  AATMIQEGMVETGFQTAMGIYQAAWAQDGLGYSFQTPEAWDVDDRFRSIGYMRPLAIWAMQ
Full Sequence
Protein Sequence     Length: 945     Download
MEKGGNGASS TEVDPSKPPS LTWKRKLDFT GKSPESFSFT LTDAWHMGMT GYRLWRNGKE    60
EIAKGRIPIY EFFSDVPITC YHGVSLGGIG AGSIGRSYRG EFQRFQMFYG PCEDEPVLAN    120
QFSVFVSRPN GNKFSSVLCS AKPQKSKDGK QTGIESWDWN LSGENSTYHA LFPRSWTVYD    180
GEPDPDLKIV CRQMSPIIPH NYKESSFPVS VFTFKLSNEG QTSAQVTLLF TWANSVGGKS    240
GFTGHHFNSK MGAEDGAQGV LLHHKSANGR PTVTYGIAAE ATDDVHVSLC PCFVISGDSE    300
GISAKDMWQE IKNHGSFDNL GSVGANEGSK PGCSIGAAVA ATLTIPPTSA RTVTFSLAWD    360
CPEVKFDGKT YHRQYSKFYG TLGDAAEIIA RDAISKHGKW EAEIEAWQRP IIEDKRLPDW    420
YPVTLFNELY FLNSGGTIWT DGLPPLQNLS TISHKKYFLE RSKSELNGGA PNGDHRKDVA    480
VDILERMSQI LDQTHGGAGP SNAALGTRLL HPGEENVGNL LLVEGSQYLM WNTYDVHFYS    540
SFALIMLFPK LELSIQRDFA AAVLMHDPRK AKTMCDGNWV PRKVLGAVPH DIGFNDPWLE    600
VNAYNLLNVS RWKDLGSKFV LQVYRDVVAT GDKNFAKSVW PSVYVALAFM EQFDKDKDGM    660
IENEGFPDQT YDTWTVKGVS AYCGGLWVAA LQAASALASE VDDEAAAHYF WIKYQKARSV    720
YETLWNGSYF NYDNSKGPWS SSIQADQLAG QWYARACGLC PIADEEKIRV ALEKIYNFNV    780
MKVKGGTRGA VNGMFPDGSV DKSILQPKEI WAGVTYSVAA TMIQEGMVET GFQTAMGIYQ    840
AAWAQDGLGY SFQTPEAWDV DDRFRSIGYM RPLAIWAMQW AMMSDSKPTK VPTKAFSEMQ    900
ESAFATQHAA FLKVASLLKL PSNDDTARRS LVEAAYDFIC KRSA*                    960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG4354COG43548.0e-3282441373+
pfam12215GBA2_N3.0e-6483400327+
COG4354COG43544.0e-68535882367+
pfam04685DUF6082.0e-157524880361+
Gene Ontology
GO TermDescription
GO:0004348glucosylceramidase activity
GO:0006665sphingolipid metabolic process
GO:0016021integral to membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI31319.10894217946unnamed protein product [Vitis vinifera]
RefSeqXP_002264575.10294212946PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002275782.10894233962PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002325943.10519425888predicted protein [Populus trichocarpa]
RefSeqXP_002525532.10894218945conserved hypothetical protein [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY2920403535318800
JG47255524712470
FC9176483055318350
JG7030273285368630
DV6336072334336650
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00087.2Aquca_017_00087.1Aquca_034_00116.1
Arabidopsis lyrata331392479911473529327181
Arabidopsis thalianaAT1G33700.2AT1G33700.1AT5G49900.1AT3G24180.2AT3G24180.1
AT4G10060.1
Brachypodium distachyonBradi3g28580.1Bradi4g21277.1Bradi3g13487.1Bradi1g28847.1Bradi3g13520.1
Brassica rapaBra014964Bra028008Bra000598Bra028320Bra033199
Carica papayaevm.model.supercontig_59.121evm.model.supercontig_21.79evm.model.supercontig_113.12
Capsella rubellaCarubv10025826mCarubv10012912mCarubv10008221mCarubv10002637m
Citrus clementinaCiclev10004255mCiclev10000199mCiclev10018743mCiclev10018742m
Citrus sinensisorange1.1g039165morange1.1g002202morange1.1g038924m
Cucumis sativusCucsa.266300.2Cucsa.266300.1Cucsa.023010.1Cucsa.237200.2
Eucalyptus grandisEucgr.I02786.1Eucgr.H02851.2Eucgr.H02851.1Eucgr.H00075.1Eucgr.F02980.1
Eucgr.F02980.2
Fragaria vescamrna29905.1-v1.0-hybridmrna02278.1-v1.0-hybrid
Glycine maxGlyma10g33610.1Glyma20g33990.1Glyma07g40310.2
Gossypium raimondiiGorai.008G046700.1Gorai.011G160300.5Gorai.011G160300.4Gorai.011G160300.3Gorai.011G160300.2
Gorai.011G160300.1Gorai.013G133800.2Gorai.013G133800.1Gorai.006G221200.3Gorai.006G221200.2
Gorai.006G221200.1Gorai.008G046700.3Gorai.008G046700.2.531.722Gorai.008G046700.2.531.722Gorai.008G046700.2.724.851
Gorai.008G046700.2.724.851
Linum usitatissimumLus10000757Lus10003517Lus10002950Lus10023340Lus10038471
Lus10038469
Malus domesticaMDP0000175141MDP0000220028MDP0000128604
Manihot esculentacassava4.1_001108mcassava4.1_002224mcassava4.1_003299mcassava4.1_005809m
Medicago truncatulaMedtr1g072720.1Medtr1g072680.1
Mimulus guttatusmgv1a000876mmgv1a000873m
Oryza sativaLOC_Os10g33420.1LOC_Os11g13810.1LOC_Os08g01940.2LOC_Os08g01940.1LOC_Os07g26210.1
LOC_Os07g26210.2
Panicum virgatumPavirv00047844mPavirv00042892mPavirv00041095mPavirv00002207mPavirv00050055m
Pavirv00014420mPavirv00035631mPavirv00038108m
Physcomitrella patensPp1s134_55V6.1Pp1s40_202V6.1
Phaseolus vulgarisPhvul.007G134300.1Phvul.003G075400.1
Picea abiesMA_10430605g0020MA_10431145g0020MA_61180g0010MA_35878g0010MA_10426003g0020.110.198
MA_10426003g0020.110.198MA_165077g0010
Populus trichocarpaPotri.T163400.1Potri.019G072800.2Potri.019G072800.1Potri.004G227200.4Potri.004G227200.2
Potri.004G227200.1Potri.003G178000.4Potri.003G178000.3Potri.003G178000.2Potri.003G178000.1
Potri.003G003400.1Potri.003G003400.2Potri.019G072800.3Potri.004G227200.3Potri.003G003400.3
Prunus persicappa001012mppa000954m
Ricinus communis29685.m00048429757.m00075229904.m002967
Setaria italicaSi034088mSi026057mSi025923mSi029270mSi028945m
Si028854mSi013210mSi026013m
Selaginella moellendorffii16663492385
Sorghum bicolorSb01g019510.2Sb01g019510.1Sb05g007160.1Sb0073s002050.1Sb07g001140.1
Thellungiella halophilaThhalv10006714mThhalv10012588mThhalv10020003mThhalv10020001m
Vitis viniferaGSVIVT01036381001GSVIVT01023217001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)