y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCucumis sativus
Cazyme IDCucsa.242270.1
FamilyAA7
Protein PropertiesLength: 567 Molecular Weight: 62508.5 Isoelectric Point: 6.2041
ChromosomeChromosome/Scaffold: 02047 Start: 2019167 End: 2030623
DescriptionFAD-linked oxidases family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA71443381.3e-25
  IPDVVVFPRSEEEVSEIIKLCDQYKVPIVPYGGATSIEGHTLAPNGGLCIDMSLMNKVKALHVEDMDVTVEPGIGWMELNEYLEPYGLFFPLDPGPGATI
  GGMCATRCSGSLAVRYGTMRDNVINLKAVLANGDVVKTASRARKSAAGYDLTRLMIGSEGTLGVITEITLRLQKLPEYSVVAMCNFPSIKDAADV
Full Sequence
Protein Sequence     Length: 567     Download
MAFSSWFSRF RSSSNSLYHS LFRGASFQNL GAQTSVISRT SSSQNGGRRF LLWSTSVVPF    60
ALAGSLAFQF QLQSHSSFCD DSDIHDRFGG KDSTEYVVKG SHNDISQPFI DKLGRICKDN    120
MTLDYDERYF HGKPQNSFHV AVNIPDVVVF PRSEEEVSEI IKLCDQYKVP IVPYGGATSI    180
EGHTLAPNGG LCIDMSLMNK VKALHVEDMD VTVEPGIGWM ELNEYLEPYG LFFPLDPGPG    240
ATIGGMCATR CSGSLAVRYG TMRDNVINLK AVLANGDVVK TASRARKSAA GYDLTRLMIG    300
SEGTLGVITE ITLRLQKLPE YSVVAMCNFP SIKDAADVAI ATMLSGIQVS RMELLDEVQV    360
RAINNANGKN LPESPTLMFE FIGTEAYSRE QTLIVQQIVS EHNGSDFVFA EDPEAKKELW    420
KIRKEALWAC FALVPHFEAM ITDVCVPLSH LAELISSSKR ELDASSLVCT VIAHAGDGNF    480
HTVILFDPKE EKQRKEAERL NHMMVYKALS MEGTCTGEHG VGTGKMKYLE KELGLEALRT    540
MKRIKTALDP NNIMNPGKLI PPHICF*                                        600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK11230PRK112302.0e-51144565427+
pfam02913FAD-oxidase_C8.0e-71318559247+
TIGR00387glcD2.0e-100148558415+
COG0277GlcD1.0e-126118562458+
PLN02805PLN02805025566547+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0008762UDP-N-acetylmuramate dehydrogenase activity
GO:0016491oxidoreductase activity
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001142976.108156670555hypothetical protein LOC100275430 [Zea mays]
RefSeqNP_568170.1015661567FAD linked oxidase family protein [Arabidopsis thaliana]
RefSeqXP_002267321.1015661566PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002322755.10885661480predicted protein [Populus trichocarpa]
RefSeqXP_002524111.1015661555d-lactate dehydrogenase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3pm9_F6.99949e-4214756054476A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
PDB3pm9_E6.99949e-4214756054476A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
PDB3pm9_D6.99949e-4214756054476A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
PDB3pm9_C6.99949e-4214756054476A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
PDB3pm9_B6.99949e-4214756054476A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX2650383231594800
AM7369152772915670
DY3055873712015660
EX2616063222165330
EX261606505145630.14
Orthologous Group
SpeciesID
Arabidopsis lyrata487468
Brassica rapaBra009208
Carica papayaevm.model.supercontig_222.7
Capsella rubellaCarubv10000524m
Citrus clementinaCiclev10011373m
Citrus sinensisorange1.1g011962morange1.1g015664morange1.1g015624morange1.1g008252m
Eucalyptus grandisEucgr.A02536.1
Fragaria vescamrna18037.1-v1.0-hybrid
Glycine maxGlyma03g36390.2Glyma03g36390.1
Gossypium raimondiiGorai.006G146800.1
Malus domesticaMDP0000293317MDP0000201766
Manihot esculentacassava4.1_004573m
Mimulus guttatusmgv1a003632m
Physcomitrella patensPp1s18_85V6.1
Phaseolus vulgarisPhvul.001G199000.1
Picea abiesMA_9447266g0050
Populus trichocarpaPotri.016G064800.13Potri.016G064800.1Potri.016G064800.10Potri.016G064800.11Potri.016G064800.2
Potri.016G064800.3Potri.016G064800.4Potri.016G064800.5Potri.016G064800.6Potri.016G064800.7
Potri.016G064800.8Potri.016G064800.9Potri.016G064800.12
Prunus persicappa003803m
Ricinus communis29333.m001099
Thellungiella halophilaThhalv10013121m
Vitis viniferaGSVIVT01022507001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny