y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCucumis sativus
Cazyme IDCucsa.266300.2
FamilyGH116
Protein PropertiesLength: 746 Molecular Weight: 84056.1 Isoelectric Point: 5.9166
ChromosomeChromosome/Scaffold: 02352 Start: 825784 End: 830178
DescriptionBeta-glucosidase, GBA2 type family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1163276890
  GRFLYLEGVEYVMWCTYDVHFYASYALLELFPKIELNIQRDFAKAVLSEDGRKVRFLAEGKYGIRKVRGAVPHDLGTHDPWNEMNAYNIHDTSRWKDLNT
  KFVLQVYRDFAATRDMSFGVDVWPSVRAAIEYMEQFDRDGDGVIENDGFPDQTYDTWTVHGISAYCGCLWVAALQAAAAMAHELGDQEFAETCKSKFLKA
  RPVLEAELWNGSYFNYDSGSSSNSKSIQADQLAGQWYTASSGLPPLFDDFKIKSALRKIYDFNVMKVRGGRMGAVNGMHPNGKIDETCMQSREIWTGVTY
  GVAATMILAGMEEEAFKTAEGIFLAGWSEEGFGYWFQTPEAWSTDGHYRSLIYMRPLSIWGMQ
Full Sequence
Protein Sequence     Length: 746     Download
MTKIKFPDKL LDLVVQFCLT SNLVAGFYSW FVCFWCISPK KNSKDLCKCF RTAKGNPPVT    60
FAIAACETQN VSVTVLPSFG LSEGSCITAK DMWDKMVQDG QFDRDNFSSG PSMPSSPGET    120
LCAAVAASAW VEPHGKCTVA FSLSWSSPKV KFLKGFSYHR RYTKFYGTSG KAAQTLAHDA    180
LTNYKRWEEE IEKWQRPVLM DERLPEWYKF TLFNELYFLV AGGTVWIDSS FVGKKASYDQ    240
DHLARLKNDD VKAVEAKVSG RGEEVSRTTT TTTLDGFPSI EYDDENSTSS SHASEDELMV    300
PLKRGYTDRS YQTYKVLEPG NTEEDVGRFL YLEGVEYVMW CTYDVHFYAS YALLELFPKI    360
ELNIQRDFAK AVLSEDGRKV RFLAEGKYGI RKVRGAVPHD LGTHDPWNEM NAYNIHDTSR    420
WKDLNTKFVL QVYRDFAATR DMSFGVDVWP SVRAAIEYME QFDRDGDGVI ENDGFPDQTY    480
DTWTVHGISA YCGCLWVAAL QAAAAMAHEL GDQEFAETCK SKFLKARPVL EAELWNGSYF    540
NYDSGSSSNS KSIQADQLAG QWYTASSGLP PLFDDFKIKS ALRKIYDFNV MKVRGGRMGA    600
VNGMHPNGKI DETCMQSREI WTGVTYGVAA TMILAGMEEE AFKTAEGIFL AGWSEEGFGY    660
WFQTPEAWST DGHYRSLIYM RPLSIWGMQW ALSLPKAILD APKINVMDRI HVSSSNTKFF    720
NHETGVRRIA TKAKCFGDSV FNCAC*                                         780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3408GDB10.002394517142+
COG4354COG43541.0e-1114122888+
pfam12215GBA2_N2.0e-1560187129+
COG4354COG43545.0e-62326692388+
pfam04685DUF6085.0e-152327690367+
Gene Ontology
GO TermDescription
GO:0004348glucosylceramidase activity
GO:0006665sphingolipid metabolic process
GO:0016021integral to membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAB01359.1050745271937unnamed protein product [Arabidopsis thaliana]
EMBLCAN61187.1051745171900hypothetical protein [Vitis vinifera]
RefSeqXP_002285674.1051745285978PREDICTED: similar to catalytic [Vitis vinifera]
RefSeqXP_002303825.1054745279966predicted protein [Populus trichocarpa]
RefSeqXP_002518119.1051745285968conserved hypothetical protein [Ricinus communis]
Transmembrane Domains
StartEnd
1335
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7798602794697460
HO7798601732984700
HO779860841822650
GT0459923383937300
GO8565583394017390
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00087.2Aquca_017_00087.1Aquca_034_00116.1
Arabidopsis lyrata331392479911473529327181
Arabidopsis thalianaAT1G33700.2AT1G33700.1AT5G49900.1AT3G24180.2AT3G24180.1
AT4G10060.1
Brachypodium distachyonBradi3g28580.1Bradi4g21277.1Bradi3g13487.1Bradi1g28847.1Bradi3g13520.1
Brassica rapaBra014964Bra028008Bra000598Bra028320Bra033199
Carica papayaevm.model.supercontig_59.121evm.model.supercontig_21.79evm.model.supercontig_113.12
Capsella rubellaCarubv10025826mCarubv10012912mCarubv10008221mCarubv10002637m
Citrus clementinaCiclev10004255mCiclev10000199mCiclev10018743mCiclev10018742m
Citrus sinensisorange1.1g039165morange1.1g002202morange1.1g038924m
Cucumis sativusCucsa.266300.1Cucsa.023010.1Cucsa.237200.1Cucsa.237200.2
Eucalyptus grandisEucgr.I02786.1Eucgr.H02851.2Eucgr.H02851.1Eucgr.H00075.1Eucgr.F02980.1
Eucgr.F02980.2
Fragaria vescamrna29905.1-v1.0-hybridmrna02278.1-v1.0-hybrid
Glycine maxGlyma10g33610.1Glyma20g33990.1Glyma07g40310.2
Gossypium raimondiiGorai.008G046700.1Gorai.011G160300.5Gorai.011G160300.4Gorai.011G160300.3Gorai.011G160300.2
Gorai.011G160300.1Gorai.013G133800.2Gorai.013G133800.1Gorai.006G221200.3Gorai.006G221200.2
Gorai.006G221200.1Gorai.008G046700.3Gorai.008G046700.2.531.722Gorai.008G046700.2.531.722Gorai.008G046700.2.724.851
Gorai.008G046700.2.724.851
Linum usitatissimumLus10000757Lus10003517Lus10002950Lus10023340Lus10038471
Lus10038469
Malus domesticaMDP0000175141MDP0000220028MDP0000128604
Manihot esculentacassava4.1_001108mcassava4.1_002224mcassava4.1_003299mcassava4.1_005809m
Medicago truncatulaMedtr1g072720.1Medtr1g072680.1
Mimulus guttatusmgv1a000876mmgv1a000873m
Oryza sativaLOC_Os10g33420.1LOC_Os11g13810.1LOC_Os08g01940.2LOC_Os08g01940.1LOC_Os07g26210.1
LOC_Os07g26210.2
Panicum virgatumPavirv00047844mPavirv00042892mPavirv00041095mPavirv00002207mPavirv00050055m
Pavirv00014420mPavirv00035631mPavirv00038108m
Physcomitrella patensPp1s134_55V6.1Pp1s40_202V6.1
Phaseolus vulgarisPhvul.007G134300.1Phvul.003G075400.1
Picea abiesMA_10430605g0020MA_10431145g0020MA_61180g0010MA_35878g0010MA_10426003g0020.110.198
MA_10426003g0020.110.198MA_165077g0010
Populus trichocarpaPotri.T163400.1Potri.019G072800.2Potri.019G072800.1Potri.004G227200.4Potri.004G227200.2
Potri.004G227200.1Potri.003G178000.4Potri.003G178000.3Potri.003G178000.2Potri.003G178000.1
Potri.003G003400.1Potri.003G003400.2Potri.019G072800.3Potri.004G227200.3Potri.003G003400.3
Prunus persicappa001012mppa000954m
Ricinus communis29685.m00048429757.m00075229904.m002967
Setaria italicaSi034088mSi026057mSi025923mSi029270mSi028945m
Si028854mSi013210mSi026013m
Selaginella moellendorffii16663492385
Sorghum bicolorSb01g019510.2Sb01g019510.1Sb05g007160.1Sb0073s002050.1Sb07g001140.1
Thellungiella halophilaThhalv10006714mThhalv10012588mThhalv10020003mThhalv10020001m
Vitis viniferaGSVIVT01036381001GSVIVT01023217001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)