y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCucumis sativus
Cazyme IDCucsa.273090.1
FamilyGT35
Protein PropertiesLength: 965 Molecular Weight: 108937 Isoelectric Point: 5.6611
ChromosomeChromosome/Scaffold: 02511 Start: 81268 End: 88325
DescriptionGlycosyl transferase, family 35
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT351719590
  ALSKLGYELENVASQEPDAALGNGGLGRLASCFLDSLATLNYPAWGYGLRYKYGLFKQKITKDGQEEVAENWLEIGNPWEIVRNDIKYHIKFYGKVVIGS
  DGKKNWTGGEDIEAVAHDVPIPGYKTKNTINLRLWSTKAPTEDFDLAAFNAGEHSRASEALASAEKICHVLYPGDDSIEGKILRLKQQYTLCSASLQDIV
  ERFVRRSGANIKWEEFPEKVAVQMNDTHPTLCIPELMRILLDLKGLSWEEAWNVTQRTVAYTNHTVLPEALEKWNFELMQRLLPRHVEIIELIDEELIRT
  IISEYGTADLKLLREKLKELRILENVDLPAAYSDLFIEPEESSTIASTEVLKRSKEADSVDKDEFVEVDDELESKGIQDKKVEPTPPPPPPKMVRMANLS
  VVGGHAVNGVAEIHSEIVKDEVFNAFYKLWPGKFQNKTNGVTPRRWILFCNPDLSKLITNWIGSEDWVLNTEKLGGLKKFADDEDLQNQWRIAKRNNKLK
  AVSFLKEKTGYTVSPDAMFDIQVKRIHEYKRQLLNILGIVYRYKKMKEMSAKERKETYVPRVCIFGGKAFATYVQAKRIVKFITDVGATVNHDPEIGDLL
  KVIFVPDYNVSVAELLIPASELSQHISTAGMEASGTSNMKFAMNGCILIGTLDGANVEIRQEVGADNFFLFGAEAHEIAGLRKERAEGKFIPDPRFEEVK
  EYVRSGVFGSCDYEELIASLEGNEGFGRADYFLVGKDFPSYIECQEKVDEAYRDQKKWTRMSILNTAGSYKFSSDRTIHEYAKDIWSIK
Full Sequence
Protein Sequence     Length: 965     Download
MAATSQFTLA LNPPHSFSHS YSFPSLIGLS SRYRQSKFLL LSTSSWRSPK RTFLVRNVSS    60
EPKLKDPVAD KESPTAATAF APDASSIASS IKYHAEFTPL FSPDRFDLPK AFFATAQSVR    120
DALIINWNET FELYERLNVK QAYYLSMEFL QGRALLNAIG NLELTGPYAE ALSKLGYELE    180
NVASQEPDAA LGNGGLGRLA SCFLDSLATL NYPAWGYGLR YKYGLFKQKI TKDGQEEVAE    240
NWLEIGNPWE IVRNDIKYHI KFYGKVVIGS DGKKNWTGGE DIEAVAHDVP IPGYKTKNTI    300
NLRLWSTKAP TEDFDLAAFN AGEHSRASEA LASAEKICHV LYPGDDSIEG KILRLKQQYT    360
LCSASLQDIV ERFVRRSGAN IKWEEFPEKV AVQMNDTHPT LCIPELMRIL LDLKGLSWEE    420
AWNVTQRTVA YTNHTVLPEA LEKWNFELMQ RLLPRHVEII ELIDEELIRT IISEYGTADL    480
KLLREKLKEL RILENVDLPA AYSDLFIEPE ESSTIASTEV LKRSKEADSV DKDEFVEVDD    540
ELESKGIQDK KVEPTPPPPP PKMVRMANLS VVGGHAVNGV AEIHSEIVKD EVFNAFYKLW    600
PGKFQNKTNG VTPRRWILFC NPDLSKLITN WIGSEDWVLN TEKLGGLKKF ADDEDLQNQW    660
RIAKRNNKLK AVSFLKEKTG YTVSPDAMFD IQVKRIHEYK RQLLNILGIV YRYKKMKEMS    720
AKERKETYVP RVCIFGGKAF ATYVQAKRIV KFITDVGATV NHDPEIGDLL KVIFVPDYNV    780
SVAELLIPAS ELSQHISTAG MEASGTSNMK FAMNGCILIG TLDGANVEIR QEVGADNFFL    840
FGAEAHEIAG LRKERAEGKF IPDPRFEEVK EYVRSGVFGS CDYEELIASL EGNEGFGRAD    900
YFLVGKDFPS YIECQEKVDE AYRDQKKWTR MSILNTAGSY KFSSDRTIHE YAKDIWSIKP    960
VELP*                                                                1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00343Phosphorylase2.0e-126171456286+
cd04300GT1_Glycogen_Phosphorylase1.0e-17488456373+
cd04300GT1_Glycogen_Phosphorylase0562958402+
pfam00343Phosphorylase0562960404+
TIGR02093P_ylase0562958402+
Gene Ontology
GO TermDescription
GO:0004645phosphorylase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAG31925.1019641971alpha-1,4-glucan phosphorylase L isozyme [Cucurbita maxima]
EMBLCBI22291.101496413982unnamed protein product [Vitis vinifera]
RefSeqXP_002279075.101496413958PREDICTED: similar to Alpha-1,4 glucan phosphorylase L-1 isozyme, chloroplastic/amyloplastic [Vitis vinifera]
RefSeqXP_002305367.105596416949predicted protein [Populus trichocarpa]
RefSeqXP_002526085.103096431977glycogen phosphorylase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3l7d_A0649605830A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp
PDB3l7c_A0649605830A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp
PDB3l7b_A0649605830A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp
PDB3l7a_A0649605830A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp
PDB3l79_A0649605830A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7783038641119650
HO7971784015659650
HO6207674035639650
HO6139544035639650
HO77830351641130.0000000002
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00755.3Aquca_009_00755.2Aquca_009_00755.1Aquca_002_00786.1Aquca_002_00786.2
Arabidopsis lyrata485074323006
Arabidopsis thalianaAT3G46970.1AT3G29320.1
Brachypodium distachyonBradi2g55120.1Bradi1g08070.1.569.972Bradi1g08070.1.569.972Bradi1g08070.1.163.525Bradi1g08070.1.163.525
Brassica rapaBra018180Bra025392Bra033098
Carica papayaevm.model.supercontig_27.5evm.model.supercontig_112.64.358.739evm.model.supercontig_112.64.358.739evm.model.supercontig_14.158evm.model.supercontig_112.64.117.357
evm.model.supercontig_112.64.117.357
Capsella rubellaCarubv10019408mCarubv10016634m
Chlamydomonas reinhardtiiCre12.g552200.t1.2Cre07.g336950.t1.1
Citrus clementinaCiclev10027815mCiclev10027813mCiclev10010975m.585.995Ciclev10010975m.585.995Ciclev10010975m.176.514
Ciclev10010975m.176.514
Citrus sinensisorange1.1g004485morange1.1g003202morange1.1g003197morange1.1g003196morange1.1g003188m
orange1.1g003186morange1.1g005595morange1.1g003693morange1.1g003742morange1.1g004697m
orange1.1g004696morange1.1g007597morange1.1g003875m.374.784orange1.1g003875m.374.784orange1.1g003079m.434.844
orange1.1g003079m.434.844orange1.1g003074m.434.844orange1.1g003074m.434.844orange1.1g003072m.434.844orange1.1g003072m.434.844
orange1.1g003055m.436.846orange1.1g003055m.436.846orange1.1g001879m.585.995orange1.1g001879m.585.995orange1.1g009651m
orange1.1g002111morange1.1g012447morange1.1g005402m.400.692orange1.1g005402m.400.692orange1.1g005402m.25.349
orange1.1g005402m.25.349orange1.1g003079m.25.349orange1.1g003079m.25.349orange1.1g003074m.25.349orange1.1g003074m.25.349
orange1.1g003072m.25.349orange1.1g003072m.25.349orange1.1g001879m.176.500orange1.1g001879m.176.500orange1.1g003055m.25.351
orange1.1g003055m.25.351orange1.1g026345m
Cucumis sativusCucsa.126920.10Cucsa.126920.1Cucsa.139040.4Cucsa.139040.3Cucsa.139040.2
Cucsa.139040.1Cucsa.284600.1
Eucalyptus grandisEucgr.B02278.2Eucgr.B02278.1Eucgr.B03166.3Eucgr.B03166.2Eucgr.J01374.1
Eucgr.B03166.1Eucgr.B03166.5Eucgr.B03166.4
Fragaria vescamrna29749.1-v1.0-hybridmrna07968.1-v1.0-hybridmrna04322.1-v1.0-hybrid.157.481mrna04322.1-v1.0-hybrid.157.481
Glycine maxGlyma13g30920.2Glyma13g30920.3Glyma08g45210.1Glyma18g07480.1Glyma20g03250.4.554.965
Glyma20g03250.4.554.965Glyma20g03250.3.562.973Glyma20g03250.3.562.973Glyma20g03250.2.562.973Glyma20g03250.2.562.973
Glyma13g06040.1Glyma19g03490.1Glyma20g03250.4.161.485Glyma20g03250.4.161.485Glyma20g03250.3.169.493
Glyma20g03250.3.169.493Glyma20g03250.2.169.493Glyma20g03250.2.169.493
Gossypium raimondiiGorai.009G166800.1Gorai.013G260900.2Gorai.013G260900.1Gorai.013G260900.3Gorai.006G011500.7.330.728
Gorai.006G011500.7.330.728Gorai.006G011500.4.514.912Gorai.006G011500.4.514.912Gorai.006G011500.3.580.978Gorai.006G011500.3.580.978
Gorai.006G011500.2.583.981Gorai.006G011500.2.583.981Gorai.006G011500.1.583.986Gorai.006G011500.1.583.986Gorai.013G092200.1
Gorai.013G092200.2Gorai.006G011500.6.177.501Gorai.006G011500.6.177.501Gorai.006G011500.5.180.504Gorai.006G011500.5.180.504
Gorai.006G011500.4.111.435Gorai.006G011500.4.111.435Gorai.006G011500.3.177.501Gorai.006G011500.3.177.501Gorai.006G011500.2.180.504
Gorai.006G011500.2.180.504Gorai.006G011500.1.180.504Gorai.006G011500.1.180.504Gorai.006G011500.6.580.815Gorai.006G011500.6.580.815
Gorai.006G011500.5.583.818Gorai.006G011500.5.583.818
Linum usitatissimumLus10036892Lus10042688Lus10037093Lus10029643Lus10029644
Malus domesticaMDP0000288190MDP0000123354MDP0000266061MDP0000129346.602.999MDP0000129346.602.999
MDP0000145828MDP0000128518MDP0000778598MDP0000259799MDP0000129346.170.509
MDP0000129346.170.509MDP0000211642
Manihot esculentacassava4.1_001626mcassava4.1_002082mcassava4.1_024481mcassava4.1_002466mcassava4.1_002614m.310.707
cassava4.1_002614m.310.707cassava4.1_001096mcassava4.1_025456mcassava4.1_007176mcassava4.1_004717m.211.560
cassava4.1_004717m.211.560cassava4.1_002614m.25.217cassava4.1_002614m.25.217cassava4.1_004717m.25.195cassava4.1_004717m.25.195
cassava4.1_009211m
Medicago truncatulaMedtr2g014460.1Medtr6g014480.1Medtr4g082950.1.578.876Medtr4g082950.1.578.876Medtr4g082950.1.170.494
Medtr4g082950.1.170.494Medtr6g014480.2
Mimulus guttatusmgv1a000698mmgv1a001277mmgv1a000878mmgv1a002586mmgv1a002585m
Oryza sativaLOC_Os01g63270.1LOC_Os01g63270.2LOC_Os03g55090.1
Panicum virgatumPavirv00009874mPavirv00050649mPavirv00050650mPavirv00004990m.515.914Pavirv00004990m.515.914
Pavirv00034922m.529.918Pavirv00034922m.529.918Pavirv00034922m.119.465Pavirv00034922m.119.465Pavirv00004990m.97.438
Pavirv00004990m.97.438
Physcomitrella patensPp1s30_182V6.1Pp1s180_124V6.1Pp1s86_213V6.1Pp1s195_41V6.1Pp1s53_212V6.1.566.981
Pp1s53_212V6.1.566.981Pp1s53_212V6.1.179.499Pp1s53_212V6.1.179.499
Phaseolus vulgarisPhvul.006G182300.1Phvul.006G064100.1Phvul.002G168400.1.570.971Phvul.002G168400.1.570.971Phvul.004G034400.1.582.980
Phvul.004G034400.1.582.980Phvul.002G168400.1.169.519Phvul.002G168400.1.169.519Phvul.004G034400.1.180.504Phvul.004G034400.1.180.504
Picea abiesMA_10437129g0010MA_14581g0010MA_10428980g0010
Populus trichocarpaPotri.004G048600.1Potri.004G048600.2Potri.009G041800.1Potri.009G041800.3Potri.010G160200.2
Potri.009G041800.4Potri.009G041800.2.126.655Potri.009G041800.2.126.655Potri.004G123600.5Potri.010G160200.5
Potri.010G160200.1Potri.010G160200.7Potri.010G160200.4Potri.010G160200.3Potri.004G123600.4.176.534
Potri.004G123600.4.176.534Potri.004G123600.3.176.534Potri.004G123600.3.176.534Potri.004G123600.2.176.534Potri.004G123600.2.176.534
Potri.004G123600.1.176.533Potri.004G123600.1.176.533Potri.010G160200.6Potri.009G041800.2.660.825Potri.009G041800.2.660.825
Prunus persicappa000587mppa001354mppa000958mppa000827m.586.983ppa000827m.586.983
ppa000827m.171.506ppa000827m.171.506
Ricinus communis29751.m00179630190.m011310.461.94330190.m011310.461.94330174.m00913629630.m000793
30190.m011310.264.44430190.m011310.264.444
Setaria italicaSi000306mSi034019m
Selaginella moellendorffii148158164611184206
Sorghum bicolorSb03g040060.1Sb01g007560.2.550.949Sb01g007560.2.550.949Sb01g007560.1.580.979Sb01g007560.1.580.979
Sb01g007560.2.140.492Sb01g007560.2.140.492Sb01g007560.1.170.522Sb01g007560.1.170.522
Thellungiella halophilaThhalv10010122mThhalv10003599m
Vitis viniferaGSVIVT01021111001GSVIVT01024804001GSVIVT01012194001GSVIVT01011504001.577.977GSVIVT01011504001.577.977
GSVIVT01011504001.177.501GSVIVT01011504001.177.501
Volvox carteriVocar20006426mVocar20001423m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)