y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCucumis sativus
Cazyme IDCucsa.286480.1
FamilyGT77
Protein PropertiesLength: 694 Molecular Weight: 79074.4 Isoelectric Point: 8.4009
ChromosomeChromosome/Scaffold: 02653 Start: 2508522 End: 2511205
DescriptionNucleotide-diphospho-sugar transferase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT774526720
  ISNYLVCALDSDTYKFSVLQGLPVYRDPLPPTNISFNDCHFGTECFQRVTKVKSRMVLRILKLGYNVLLSDVDVYWFMNPLPFIYTFGSGVLVAQSDEYK
  KTGPINLPRRLNSGFYFARSDESTIAAMEKVVKHATTSEQSEQPSFYDTLCGEGGINRVGSNKCLEPETNLTIHFLDRNLFPNGAYQGLWNKKNVKSACR
  KKGCFVLHNNWISGRLKKLER
Full Sequence
Protein Sequence     Length: 694     Download
MKVLGPSDSI FFFSLILLFL FSSCFLSISR QAIEAGLCSI WLSGLLLIAL SLYATQCLPS    60
FKDHFVKPEL GSKTLGDSLN PSISIFSAPR RFVGNIGVRQ SLAIRSWLAL SPQITVILFS    120
QDPSIVSSAS SFSSRVYIDS DIDFTFLGTP YFHSMMARSQ SFASDIFAFV DPETILLPDF    180
ISTLNYAYKL DRDWLLVVSS RNISYIPFYF NESKSYLSME DKQFTRIQKE LLNEHWQWSY    240
CGGKELIAWN SWDSPLHGGV LPPFLYGRGI HNNWVINEAM ASEFRFVFDA SWTISSLYLQ    300
DLEQPSSGRN EYSNSSVNGT RSWEYFGNHH LGSIYGSSFH PQAKNLTLMK LLKCNGHYIL    360
INTTENTLNQ FVFGRKKKPT TCDHNFRSLE KLQNCSVTNG ISYSETLELP FSLELLLPLV    420
ADKNKTIVLA IAGYSYKDML MSWVCRLRRL QISNYLVCAL DSDTYKFSVL QGLPVYRDPL    480
PPTNISFNDC HFGTECFQRV TKVKSRMVLR ILKLGYNVLL SDVDVYWFMN PLPFIYTFGS    540
GVLVAQSDEY KKTGPINLPR RLNSGFYFAR SDESTIAAME KVVKHATTSE QSEQPSFYDT    600
LCGEGGINRV GSNKCLEPET NLTIHFLDRN LFPNGAYQGL WNKKNVKSAC RKKGCFVLHN    660
NWISGRLKKL ERQMFSGLWD YDMSTRMCNH NLQX                                720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans5.0e-50452673223+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAG52325.101556881534AC011663_4 hypothetical protein; 72471-70598 [Arabidopsis thaliana]
EMBLCAN65937.101556931538hypothetical protein [Vitis vinifera]
EMBLCBI18645.10426931611unnamed protein product [Vitis vinifera]
RefSeqXP_002271910.101556931555PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002312675.101556881549predicted protein [Populus trichocarpa]
Transmembrane Domains
StartEnd
1029
3655
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EL3424482494406880
EX1364523013436410
EL3544682684216880
GO9564462224676880
GO956446314524820.008
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_094_00019.1Aquca_094_00019.2Aquca_094_00019.3Aquca_094_00019.4
Arabidopsis lyrata476193
Arabidopsis thalianaAT1G70630.1
Brachypodium distachyonBradi2g19997.1
Brassica rapaBra016198
Carica papayaevm.model.supercontig_33.19
Capsella rubellaCarubv10019952mCarubv10020113m
Citrus clementinaCiclev10033870m
Citrus sinensisorange1.1g043225m
Eucalyptus grandisEucgr.B03287.1
Glycine maxGlyma18g20856.1Glyma08g38866.1
Gossypium raimondiiGorai.005G178600.1Gorai.005G178600.2
Linum usitatissimumLus10036860Lus10006212
Malus domesticaMDP0000300726
Manihot esculentacassava4.1_024537m
Medicago truncatulaMedtr8g069400.1
Mimulus guttatusmgv1a025056mmgv1a022943m
Oryza sativaLOC_Os05g43810.1
Panicum virgatumPavirv00043566mPavirv00008500m
Physcomitrella patensPp1s151_80V6.1Pp1s21_134V6.1
Phaseolus vulgarisPhvul.003G065100.1
Picea abiesMA_10426353g0010
Populus trichocarpaPotri.008G186800.1
Prunus persicappa019665m
Ricinus communis27504.m000645
Selaginella moellendorffii76356
Sorghum bicolorSb09g025390.1
Thellungiella halophilaThhalv10018343m
Vitis viniferaGSVIVT01005754001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny