CAZyme Information

Basic Information
SpeciesCucumis sativus
Cazyme IDCucsa.307020.3
FamilyAA2
Protein PropertiesLength: 228 Molecular Weight: 25531.4 Isoelectric Point: 8.6788
ChromosomeChromosome/Scaffold: 02977 Start: 354912 End: 357617
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA232064.4e-32
  NFKYVNKIKAAVEKECPLTVSCADIVALSARDGIVMLKGPHIDLKTGRKDSKMSYSNMVEELVPQHNASLVNVLSRFNSIGIDTEATVALLGSHSVGRVH
  CVNLVERLYPTVDPTIDPEYAKYLKMRCPTPTPDPNGVLYSRNDRETTMILDNMYYSNVLKHKGLLIVDQELVSNPLTLPYVKKFAADNLYFHAQFSRGI
  RLLS
Full Sequence
Protein Sequence     Length: 228     Download
MRNFKYVNKI KAAVEKECPL TVSCADIVAL SARDGIVMLK GPHIDLKTGR KDSKMSYSNM    60
VEELVPQHNA SLVNVLSRFN SIGIDTEATV ALLGSHSVGR VHCVNLVERL YPTVDPTIDP    120
EYAKYLKMRC PTPTPDPNGV LYSRNDRETT MILDNMYYSN VLKHKGLLIV DQELVSNPLT    180
LPYVKKFAAD NLYFHAQFSR GIRLLSENNP LTGDQGEVRK DCRFVNK* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00141peroxidase3.0e-516019031+
cd00314plant_peroxidase_like2.0e-137200219+
pfam00141peroxidase3.0e-2849895+
PLN03030PLN030304.0e-331226236+
cd00693secretory_peroxidase1.0e-961225230+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAL24415.1012261227putative peroxidase ATP2a [Arabidopsis thaliana]
GenBankACN97181.101226104329peroxidase [Populus trichocarpa]
GenBankACT35471.10122638264peroxidase 21 [Brassica rapa]
RefSeqNP_001118461.10122670296peroxidase 21 (PER21) (P21) (PRXR5) [Arabidopsis thaliana]
RefSeqXP_002326343.101226104329predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1bgp_A2e-39422685305A Chain A, Crystal Structure Of Barley Grain Peroxidase 1
PDB1gwo_A3e-39222776307A Chain A, Recombinant Horseradish Peroxidase C1a Ala170gln
PDB1gx2_B7e-39222776307A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid
PDB1gx2_A7e-39222776307A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid
PDB1gw2_A9e-39222775306A Chain A, Recombinant Horseradish Peroxidase C1a Thr171ser In Complex With Ferulic Acid
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
AM718649213162280
JG551555189402280
FY44046222712260
EV54149122712260
FY44189522712260
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_001_00478.1Aquca_005_00071.2Aquca_005_00071.1Aquca_016_00057.1Aquca_005_00071.3
Arabidopsis lyrata898035492673345443
Arabidopsis thalianaAT3G17070.1AT2G37130.2AT2G37130.1AT4G21960.1
Brassica rapaBra022195Bra017206Bra023099Bra013576
Carica papayaevm.model.supercontig_152.14evm.model.supercontig_525.1
Capsella rubellaCarubv10014103mCarubv10023623mCarubv10005223m
Citrus clementinaCiclev10026124mCiclev10026035mCiclev10012170mCiclev10015870mCiclev10016494m
Citrus sinensisorange1.1g045164morange1.1g020143morange1.1g020084morange1.1g021519morange1.1g019854m
orange1.1g019129morange1.1g021841morange1.1g026488morange1.1g020712morange1.1g021207m
orange1.1g028028morange1.1g036121m
Cucumis sativusCucsa.307020.2Cucsa.307020.1Cucsa.085830.1Cucsa.124250.1
Eucalyptus grandisEucgr.E03999.1Eucgr.E04056.1Eucgr.D01322.1Eucgr.A01166.1
Fragaria vescamrna05105.1-v1.0-hybridmrna25836.1-v1.0-hybridmrna19619.1-v1.0-hybridmrna09649.1-v1.0-hybrid
Glycine maxGlyma07g39290.1Glyma17g01440.2Glyma13g20170.1Glyma10g05800.1Glyma17g01720.1
Glyma07g39020.1Glyma04g10761.1
Gossypium raimondiiGorai.011G200600.1Gorai.006G168000.3Gorai.006G168000.1Gorai.009G419100.1Gorai.006G168000.2
Gorai.009G178400.1
Linum usitatissimumLus10015074Lus10006778Lus10020045
Malus domesticaMDP0000292744MDP0000124622MDP0000303101MDP0000545323MDP0000192235
Manihot esculentacassava4.1_011604mcassava4.1_012064mcassava4.1_031903m
Medicago truncatulaMedtr6g045330.1Medtr4g132490.1Medtr4g132110.2Medtr1g066380.1Medtr4g132110.1
Medtr1g066380.2Medtr4g132110.3
Mimulus guttatusmgv1a009704mmgv1a009981mmgv1a010406mmgv1a007622mmgv1a010067m
mgv1a019681mmgv1a025816mmgv1a026804m
Oryza sativaLOC_Os07g49360.1LOC_Os05g14260.1
Panicum virgatumPavirv00050429mPavirv00010935m
Physcomitrella patensPp1s8_186V6.1Pp1s44_71V6.1Pp1s10_225V6.1Pp1s62_126V6.1Pp1s16_148V6.1
Pp1s104_177V6.3Pp1s104_177V6.2Pp1s104_177V6.1Pp1s433_15V6.2Pp1s433_15V6.1
Phaseolus vulgarisPhvul.007G107400.1Phvul.003G078600.1
Picea abiesMA_83406g0010MA_530154g0010MA_10432809g0020MA_10427936g0010MA_6481365g0010
MA_10432809g0010
Populus trichocarpaPotri.004G015300.2Potri.004G015300.1Potri.006G129900.1Potri.004G006400.1
Prunus persicappa008634mppa022386mppa008503m
Ricinus communis29842.m00359530078.m002355
Setaria italicaSi022597m
Selaginella moellendorffii10502977725116945140930107369
1370671793877725976459403456
11598223276377662
Sorghum bicolorSb09g007950.1Sb09g018150.1
Thellungiella halophilaThhalv10021081mThhalv10016921mThhalv10025680m
Vitis viniferaGSVIVT01034984001GSVIVT01025650001GSVIVT01012727001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)