y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCucumis sativus
Cazyme IDCucsa.342940.1
FamilyGH9
Protein PropertiesLength: 524 Molecular Weight: 57269.3 Isoelectric Point: 5.317
ChromosomeChromosome/Scaffold: 03356 Start: 5240549 End: 5244749
Descriptionglycosyl hydrolase 9B5
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH9555090
  KYSDALKMAMKFFDVQKSGKLVDNQISWRGDSGLKDGSDANLDLSKGMYDAGDHMKFGFPMAFTATVLSWSILEYGDQMDAVGQLDSAKDSLKWITDYLI
  NAHPSENVLYIQVGDPEVDHACWDRPETMVEKRPLIQINASVPGTEVAAETAAAMASASLVYKKSDPSYSSKLLKHAEELFSFADENRGIYSINIPEVQT
  YYNSSGYGDELLWAASWLYHATQDESYLDYVAGSNGKLYAKWGSPTWFSWDDKHAATQVLLSRLNFFGSESASKSVQVYKKTAEAVMCGLIPESPTATSS
  RTDNGLIWVSEWNSLQHPVSSAFLASLYSDYMLTSRTAKFSCNGDTYTPADLRKFAKSQADYVLGNNPLKMSYLVGYGDKFPQYVHHRGASIPADAKTKC
  KDGFKWLDSTEPNPNIAYGALVGGPFLNDTYIDSRNNSMQGEPSTYNSALVVGLL
Full Sequence
Protein Sequence     Length: 524     Download
MGEKSRSRGC CGWFLVLVVL ALIAGAIVFA VKKKSSHSDD DPAPVPGPPG AIEKKYSDAL    60
KMAMKFFDVQ KSGKLVDNQI SWRGDSGLKD GSDANLDLSK GMYDAGDHMK FGFPMAFTAT    120
VLSWSILEYG DQMDAVGQLD SAKDSLKWIT DYLINAHPSE NVLYIQVGDP EVDHACWDRP    180
ETMVEKRPLI QINASVPGTE VAAETAAAMA SASLVYKKSD PSYSSKLLKH AEELFSFADE    240
NRGIYSINIP EVQTYYNSSG YGDELLWAAS WLYHATQDES YLDYVAGSNG KLYAKWGSPT    300
WFSWDDKHAA TQVLLSRLNF FGSESASKSV QVYKKTAEAV MCGLIPESPT ATSSRTDNGL    360
IWVSEWNSLQ HPVSSAFLAS LYSDYMLTSR TAKFSCNGDT YTPADLRKFA KSQADYVLGN    420
NPLKMSYLVG YGDKFPQYVH HRGASIPADA KTKCKDGFKW LDSTEPNPNI AYGALVGGPF    480
LNDTYIDSRN NSMQGEPSTY NSALVVGLLS SLVTTSSAVQ SFT*                     540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02171PLN021712.0e-14256501454+
PLN02266PLN022667.0e-14356500452+
PLN00119PLN001197.0e-14952501456+
pfam00759Glyco_hydro_98.0e-16656500449+
PLN02345PLN02345059523469+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAF42037.103352336526cellulase2 [Pyrus communis]
RefSeqXP_002276739.1015231525PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002300715.1015231523predicted protein [Populus trichocarpa]
RefSeqXP_002307711.105352352523predicted protein [Populus trichocarpa]
RefSeqXP_002510516.1015221522endo-1,4-beta-glucanase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ksd_A0565135429A Chain A, Glactose Oxidase C383s Mutant Identified By Directed Evolution
PDB1ksc_A0565135429A Chain A, Glactose Oxidase C383s Mutant Identified By Directed Evolution
PDB1ks8_A0565135429A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB2xfg_A04851218459B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
PDB4tf4_B0555135441B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
Transmembrane Domains
StartEnd
931
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GR2182823121915010
GR2182833121915010
ES8173623211224400
DY2895473231694890
HO7820383152145240
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00072.3Aquca_007_00072.2Aquca_007_00072.1
Arabidopsis lyrata472218895440
Arabidopsis thalianaAT1G75680.1AT1G19940.1
Brachypodium distachyonBradi4g36240.1Bradi1g35220.1
Brassica rapaBra025783Bra008214Bra015827Bra012198
Carica papayaevm.model.supercontig_26.31evm.model.supercontig_6.239
Capsella rubellaCarubv10020139mCarubv10008868m
Citrus clementinaCiclev10003402mCiclev10000849mCiclev10025306m
Citrus sinensisorange1.1g009846morange1.1g036398morange1.1g048736m
Eucalyptus grandisEucgr.I02356.1Eucgr.F01640.1
Fragaria vescamrna14858.1-v1.0-hybridmrna08501.1-v1.0-hybrid
Glycine maxGlyma02g05510.2Glyma02g05510.1Glyma04g02740.1Glyma06g02760.1Glyma16g23930.2
Gossypium raimondiiGorai.002G123700.1Gorai.009G195400.1Gorai.007G195700.1Gorai.010G005200.1Gorai.009G195400.2
Gorai.009G195400.3Gorai.009G195400.4
Linum usitatissimumLus10025965Lus10033156Lus10034515Lus10014265
Malus domesticaMDP0000140066.57.384MDP0000250849MDP0000140066.57.384MDP0000147635
Manihot esculentacassava4.1_005604mcassava4.1_005517mcassava4.1_005180mcassava4.1_021748m
Medicago truncatulaMedtr8g075990.1Medtr3g113720.1
Mimulus guttatusmgv1a004472mmgv1a004578m
Oryza sativaLOC_Os09g36350.2LOC_Os06g50140.1LOC_Os09g36350.1
Panicum virgatumPavirv00061954mPavirv00002469mPavirv00006523mPavirv00002468m
Physcomitrella patensPp1s308_21V6.1Pp1s60_116V6.1
Phaseolus vulgarisPhvul.009G016100.1Phvul.003G262600.1
Picea abiesMA_132273g0020
Populus trichocarpaPotri.005G115400.1Potri.005G237700.1Potri.002G023900.1
Ricinus communis30170.m01379027471.m000417
Setaria italicaSi006241mSi029476m
Selaginella moellendorffii77612144066
Sorghum bicolorSb10g030140.1Sb02g030990.1
Thellungiella halophilaThhalv10007364mThhalv10018397m
Vitis viniferaGSVIVT01018793001GSVIVT01009881001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny