| Basic Information | |
|---|---|
| Species | Cucumis sativus |
| Cazyme ID | Cucsa.356360.1 |
| Family | GH28 |
| Protein Properties | Length: 143 Molecular Weight: 15597.6 Isoelectric Point: 5.7104 |
| Chromosome | Chromosome/Scaffold: 03577 Start: 1124260 End: 1125746 |
| Description | Pectin lyase-like superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH28 | 3 | 130 | 2.9e-37 |
| EPGVGNITVANAIFYGTQNGLRIKSWARPSTGFVYGVQFLGATMHNVQNPILIDQHYCPNNFDCPDQESGIKISNIIYKDIVGTSATPIAIKFDCSSKNP CNGIRLEDVRLTYQNEEAKSSCEYAKGK | |||
| Full Sequence |
|---|
| Protein Sequence Length: 143 Download |
| MNEPGVGNIT VANAIFYGTQ NGLRIKSWAR PSTGFVYGVQ FLGATMHNVQ NPILIDQHYC 60 PNNFDCPDQE SGIKISNIIY KDIVGTSATP IAIKFDCSSK NPCNGIRLED VRLTYQNEEA 120 KSSCEYAKGK TLGLVQPEGC FE* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02218 | PLN02218 | 2.0e-27 | 6 | 138 | 133 | + polygalacturonase ADPG | ||
| PLN02188 | PLN02188 | 8.0e-31 | 2 | 140 | 143 | + polygalacturonase/glycoside hydrolase family protein | ||
| pfam00295 | Glyco_hydro_28 | 4.0e-34 | 2 | 128 | 127 | + Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes is important in cell wall metabolism. | ||
| PLN02793 | PLN02793 | 1.0e-34 | 6 | 141 | 137 | + Probable polygalacturonase | ||
| PLN02155 | PLN02155 | 1.0e-50 | 1 | 141 | 142 | + polygalacturonase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004650 | polygalacturonase activity |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CBI23356.1 | 0 | 1 | 141 | 248 | 390 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002262690.1 | 0 | 1 | 141 | 258 | 400 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002262719.1 | 0 | 1 | 141 | 259 | 401 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002276729.1 | 0 | 1 | 141 | 259 | 401 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002315106.1 | 0 | 1 | 141 | 257 | 397 | predicted protein [Populus trichocarpa] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1bhe_A | 0.0000001 | 5 | 114 | 261 | 362 | A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora |
| PDB | 2iq7_G | 0.001 | 6 | 123 | 213 | 329 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
| PDB | 2iq7_F | 0.001 | 6 | 123 | 213 | 329 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
| PDB | 2iq7_E | 0.001 | 6 | 123 | 213 | 329 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
| PDB | 2iq7_D | 0.001 | 6 | 123 | 213 | 329 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| JG579253 | 140 | 2 | 141 | 0 |
| DW358331 | 139 | 3 | 141 | 0 |
| DW358267 | 139 | 3 | 141 | 0 |
| DW356883 | 139 | 3 | 141 | 0 |
| DW356223 | 139 | 3 | 141 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |