Basic Information | |
---|---|
Species | Cucumis sativus |
Cazyme ID | Cucsa.358270.1 |
Family | GT1 |
Protein Properties | Length: 146 Molecular Weight: 16346.3 Isoelectric Point: 4.2334 |
Chromosome | Chromosome/Scaffold: 03585 Start: 124 End: 562 |
Description | UDP-glucosyl transferase 85A2 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT1 | 17 | 143 | 1.7e-30 |
ECIEWLNSKQPNSVVYVNFGSITVMTPQQMVEFAWGLADSGKPFLWITRPDLIVGDSAIMPQEFVTQTKDRSLIASWCSQEQVLNHPSIGGFLTHSGWNS TLESICAGVPMISWPFFAEQQTNCRYC |
Full Sequence |
---|
Protein Sequence Length: 146 Download |
DEKLTAIGSN LWAEESECIE WLNSKQPNSV VYVNFGSITV MTPQQMVEFA WGLADSGKPF 60 LWITRPDLIV GDSAIMPQEF VTQTKDRSLI ASWCSQEQVL NHPSIGGFLT HSGWNSTLES 120 ICAGVPMISW PFFAEQQTNC RYCCTX |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
PLN02448 | PLN02448 | 6.0e-38 | 14 | 141 | 128 | + UDP-glycosyltransferase family protein |
PLN00164 | PLN00164 | 5.0e-38 | 15 | 139 | 134 | + glucosyltransferase; Provisional |
PLN02410 | PLN02410 | 5.0e-40 | 9 | 142 | 136 | + UDP-glucoronosyl/UDP-glucosyl transferase family protein |
PLN02534 | PLN02534 | 3.0e-40 | 8 | 139 | 135 | + UDP-glycosyltransferase |
PLN02555 | PLN02555 | 4.0e-41 | 16 | 142 | 129 | + limonoid glucosyltransferase |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0008152 | metabolic process |
GO:0016758 | transferase activity, transferring hexosyl groups |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CAN60444.1 | 0 | 1 | 145 | 255 | 399 | hypothetical protein [Vitis vinifera] |
RefSeq | XP_002263056.1 | 0 | 1 | 145 | 269 | 413 | PREDICTED: hypothetical protein isoform 1 [Vitis vinifera] |
RefSeq | XP_002263100.1 | 0 | 1 | 145 | 249 | 393 | PREDICTED: hypothetical protein isoform 2 [Vitis vinifera] |
RefSeq | XP_002263158.1 | 0 | 6 | 145 | 267 | 406 | PREDICTED: hypothetical protein isoform 1 [Vitis vinifera] |
RefSeq | XP_002263277.1 | 0 | 6 | 145 | 247 | 386 | PREDICTED: hypothetical protein isoform 2 [Vitis vinifera] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2pq6_A | 0 | 2 | 144 | 269 | 411 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 2vg8_A | 5e-37 | 14 | 139 | 254 | 392 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 2vch_A | 5e-37 | 14 | 139 | 254 | 392 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 2vce_A | 5e-37 | 14 | 139 | 254 | 392 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
PDB | 3hbj_A | 9e-32 | 13 | 139 | 258 | 380 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DN909258 | 145 | 1 | 145 | 0 |
EC947215 | 141 | 5 | 145 | 0 |
EC939102 | 140 | 6 | 145 | 0 |
EC944563 | 145 | 1 | 145 | 0 |
EC989642 | 141 | 5 | 145 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |