y PlantCAZyme

CAZyme Information

Basic Information
SpeciesEucalyptus grandis
Cazyme IDEucgr.A01181.1
FamilyGH35
Protein PropertiesLength: 670 Molecular Weight: 76181.7 Isoelectric Point: 6.4385
ChromosomeChromosome/Scaffold: 1 Start: 18318144 End: 18322321
Descriptionbeta-galactosidase 7
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH3512370
  KEGGLNAIETYVFWNAHEPLYRQYDFEGNKDLVRFIKTIQDAGLHAILRIGPYVCAEWNYGGFPVWLHNLPGVELRTNNTVYQGGPIIVARIENEYENVE
  WAYGNNGNYGVQVPWIMCQQSDAPSPMMNTCNGYYCDQFSPNNPKSPKWWTENWSGWFKDWGMKDPHRTAEDLAFAVARFFQYGGSLQNYYMYHGGTNFD
  RTAGGPYITTSYDYDAPLDEYGNLNQTKWGHLKRLHE
Full Sequence
Protein Sequence     Length: 670     Download
KEGGLNAIET YVFWNAHEPL YRQYDFEGNK DLVRFIKTIQ DAGLHAILRI GPYVCAEWNY    60
GGFPVWLHNL PGVELRTNNT VYQGGPIIVA RIENEYENVE WAYGNNGNYG VQVPWIMCQQ    120
SDAPSPMMNT CNGYYCDQFS PNNPKSPKWW TENWSGWFKD WGMKDPHRTA EDLAFAVARF    180
FQYGGSLQNY YMYHGGTNFD RTAGGPYITT SYDYDAPLDE YGNLNQTKWG HLKRLHELIM    240
SMEEILTHGV KRDVDYGNMM SGTVYMYKGK QSCFLGNANQ NQDFTVNLMG SSHTVPAWSV    300
SILPDCYTEV YNTAKINSQQ TVMVKLPNEA DDQTEPYELK WDWRPEHLES LHHGVAKGSA    360
MTANELLDQK TVTNDTSDYL WYLTSLDLSK NDSLAGKVIT LHVHTNGHIV HAFVNGKHVG    420
ESSSHLYNLH LIRLIDVKYS NRYHIKLKHG KTNWISLLSV TVGLQILFVW YKTTFKAPLG    480
SDPWWWTWQR HCLGQWPQHG RFWPSYVASE DGCIATYDYC GAYKSDKCLT NCGKPSQRWY    540
HIPCSFLQDD GNKLVLFEEF GGTPLHVRFQ TVTAGTICAT TDEKMKLELS CQDGRVMSEI    600
KFASFSEPIG VYGSYARGSC EAPNTLSVIQ KQCLGQKSCT LDVSENTFGP TGCHQNVSFS    660
IDFISLVSF*                                                           720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02140Gal_Lectin2.0e-1058964964+
COG1874LacA1.0e-101224317+
PLN03059PLN030592.0e-37468653209+
pfam01301Glyco_hydro_351.0e-1121239287+
PLN03059PLN030598.0e-1391480517+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005529Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates." [CHEBI:16646, GOC:mah]
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI27773.10165379822unnamed protein product [Vitis vinifera]
Swiss-ProtQ9C6W40165361766BGL15_ARATH RecName: Full=Beta-galactosidase 15; Short=Lactase 15; Flags: Precursor
RefSeqXP_002276918.10165310753PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002516237.10165864817beta-galactosidase, putative [Ricinus communis]
RefSeqXP_002516256.10165786838beta-galactosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d3a_A4e-32422450315A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB4e8d_B2e-28122342314A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB4e8d_A2e-28122342314A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB4e8c_B2e-28122342314A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose
PDB4e8c_A2e-28122342314A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO77816068215800
HO780602457124310
DY264749359884310
FC915116313883850
HO780602355275610.000008
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00261.4Aquca_034_00110.2
Brassica rapaBra013956.94.331Bra015236Bra003370Bra018721Bra013956.94.331
Carica papayaevm.model.supercontig_18.156
Citrus clementinaCiclev10007838mCiclev10004420mCiclev10000553m
Citrus sinensisorange1.1g007315morange1.1g006468morange1.1g004668morange1.1g005404m
Cucumis sativusCucsa.397380.5Cucsa.342700.4Cucsa.256570.2Cucsa.229010.2Cucsa.397380.6
Eucalyptus grandisEucgr.A01556.1.101.314Eucgr.A01556.1.101.314
Fragaria vescamrna15210.1-v1.0-hybrid
Glycine maxGlyma15g35931.1Glyma09g21980.2.142.289Glyma09g21980.2.142.289Glyma14g07700.3
Gossypium raimondiiGorai.003G059500.4Gorai.011G065300.5Gorai.003G059500.3Gorai.003G059500.2Gorai.013G223000.1.124.295
Gorai.013G223000.1.124.295
Linum usitatissimumLus10023977.605.818
Manihot esculentacassava4.1_029736m
Medicago truncatulaMedtr1g018200.2AC235665_1070.1.117.327AC235665_1070.1.117.327
Mimulus guttatusmgv1a002308m
Oryza sativaLOC_Os03g15020.3
Panicum virgatumPavirv00064750m
Picea abiesMA_217488g0010MA_14774g0010
Populus trichocarpaPotri.007G018100.3Potri.006G144500.6Potri.001G200400.4Potri.001G200400.5
Prunus persicappa002177m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny