y PlantCAZyme

CAZyme Information

Basic Information
SpeciesEucalyptus grandis
Cazyme IDEucgr.A01928.1
FamilyGH35
Protein PropertiesLength: 236 Molecular Weight: 25388.7 Isoelectric Point: 9.5716
ChromosomeChromosome/Scaffold: 1 Start: 29924454 End: 29926647
Descriptionbeta-galactosidase 12
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH351081882.8e-29
  RYTEFGGAVPYRQAEDLAFSVVRFIQNSGSFINYYMYCGGTNFGRTAGNLFIATSYDYDAPLGEYGLLREPKWSHLRDLHK
Full Sequence
Protein Sequence     Length: 236     Download
MYHPTRGSVR GGKDRGDAED ESGRQSPPAR PTLSSLDAVS PLSPRSLAGG HRSPLTPLLN    60
AARSPGGRRS PLVQSPLTPL AQPPPTPLAA HLSCCRVDSK LIIMRISRYT EFGGAVPYRQ    120
AEDLAFSVVR FIQNSGSFIN YYMYCGGTNF GRTAGNLFIA TSYDYDAPLG EYGLLREPKW    180
SHLRDLHKAI KQSEWALVSA DPAVQSLGSN QEAHVFKAGS GCAASWQTMA RSILS*        240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01301Glyco_hydro_352.0e-3010919085+
PLN03059PLN030592.0e-63109224116+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAY18074.10109224117232beta-galactosidase [Carica papaya]
GenBankAAY18075.10109224117232beta-galactosidase [Carica papaya]
EMBLCAA10064.10109224133248beta galactosidase [Carica papaya]
EMBLCAD44519.10109224137252putative beta-galactosidase [Carica papaya]
RefSeqXP_002514108.10109224261376beta-galactosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d3a_A0.0002109186245325A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_D0.0007136192277336A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_C0.0007136192277336A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_B0.0007136192277336A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_A0.0007136192277336A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HS0648531161092240
EW6883801161092240
CU5255571171092240
GW6133611161092240
CX1836751161092240
Orthologous Group
SpeciesID
Carica papayaevm.model.supercontig_24.25
Citrus clementinaCiclev10001020m
Cucumis sativusCucsa.129060.1.166.261Cucsa.129060.1.166.261
Fragaria vescamrna06528.1-v1.0-hybrid
Mimulus guttatusmgv1a022675m
Panicum virgatumPavirv00051048m
Phaseolus vulgarisPhvul.009G225100.1.146.226Phvul.009G225100.1.146.226
Picea abiesMA_10436863g0010MA_87238g0010.299.379MA_87238g0010.299.379
Ricinus communis29739.m003719.176.27329739.m003719.176.273
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny