Basic Information | |
---|---|
Species | Eucalyptus grandis |
Cazyme ID | Eucgr.D01439.1 |
Family | CBM43 |
Protein Properties | Length: 76 Molecular Weight: 8349.55 Isoelectric Point: 7.8809 |
Chromosome | Chromosome/Scaffold: 4 Start: 25493050 End: 25493854 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 2 | 70 | 3.2e-29 |
ALDWACGKGGADCAEIQPHRPCFLPNMVKDHASFAFNSYYQKFKHKGATCYFNSAAMITDLDPSHGSCK |
Full Sequence |
---|
Protein Sequence Length: 76 Download |
MALDWACGKG GADCAEIQPH RPCFLPNMVK DHASFAFNSY YQKFKHKGAT CYFNSAAMIT 60 DLDPSHGSCK FPYLP* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 9.0e-14 | 2 | 58 | 66 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 3.0e-31 | 2 | 71 | 70 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK92842.1 | 3e-37 | 2 | 75 | 46 | 119 | unknown [Populus trichocarpa] |
RefSeq | XP_002272811.1 | 6e-40 | 2 | 75 | 45 | 118 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002272918.1 | 6e-40 | 2 | 75 | 45 | 118 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002307902.1 | 3e-37 | 2 | 75 | 45 | 118 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002522909.1 | 3.00004e-41 | 1 | 75 | 43 | 117 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 0.00000000000003 | 3 | 72 | 29 | 97 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EC945425 | 74 | 2 | 75 | 3e-39 |
GH294776 | 76 | 1 | 76 | 3e-37 |
DT500003 | 75 | 2 | 76 | 7e-37 |
CV272267 | 75 | 2 | 76 | 2e-36 |
CV246773 | 75 | 2 | 76 | 3e-36 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|