CAZyme Information

Basic Information
SpeciesEucalyptus grandis
Cazyme IDEucgr.D02566.1
FamilyAA3
Protein PropertiesLength: 749 Molecular Weight: 82106.8 Isoelectric Point: 7.9349
ChromosomeChromosome/Scaffold: 4 Start: 40245808 End: 40251437
DescriptionLong-chain fatty alcohol dehydrogenase family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA32837450
  PRFPSLSIQCDAVVIGSGAGGGVVAGVLAKAGHKVLVLEKGSYCARSNLSLLEGPTMDQMYLSGGLVATEDMSTLVLAGSTVGGGSTINWSASLRTPQHV
  MNEWSNKYDLELFDSKLYQEALDVVCKRMGVQSAISEEGFNNAVLRKGCQELGYPVSNIPRNSPADHYCGWCCLGCKDGKKKGTAETWLVDLVESGNGAI
  LPGCEAIEVLHTRRSGRGRDTVTGVAFEFEHNGFKEVCIVESNVTIVACGALGTPALLKRSGLKNPNIGKNLHLHPVAMAWGYFPDTKTVDLWPEKEKKS
  YEGGIMTAMDKGSGTIASSTSISYKMDDTDEHNLQKGLEKVLRILAAAGAEEIGTHHNEGKTLKVKQVSYHEFERFVKEESARPIKGQSTPICSAHQMGS
  CRMGPNPRSSVVNPMGETWEVEGLYVADTSVFPTALGVNPMVTVQAIAYCTAQSVLEALRRKK
Full Sequence
Protein Sequence     Length: 749     Download
MGKGDAKLRG SHDHYNVAIE LGHDEKFGGG GGEGRRVSYV NSLSPRQMET LTSLCDTFLP    60
SIAHPHHPSD TEGEGDEEVA KFYQTSASMA GTPEKIGGLV SERMKHPKLW LLPLTLWLLS    120
TCIGTFILCG RKCFSSHFPY VQRFSEIPQR RREEIARRWF RSVFPVLRMF ARTIKLLTFL    180
VFFTQLDEKD RNLSWKAIGY AGPDPDFENS KKLKRMSCQV SADEQQGQEQ AKAKNCYEDE    240
AISGPLHQGL IQMVHPQDIV TKSLRQFGFP VLICPSNHNV RKPRFPSLSI QCDAVVIGSG    300
AGGGVVAGVL AKAGHKVLVL EKGSYCARSN LSLLEGPTMD QMYLSGGLVA TEDMSTLVLA    360
GSTVGGGSTI NWSASLRTPQ HVMNEWSNKY DLELFDSKLY QEALDVVCKR MGVQSAISEE    420
GFNNAVLRKG CQELGYPVSN IPRNSPADHY CGWCCLGCKD GKKKGTAETW LVDLVESGNG    480
AILPGCEAIE VLHTRRSGRG RDTVTGVAFE FEHNGFKEVC IVESNVTIVA CGALGTPALL    540
KRSGLKNPNI GKNLHLHPVA MAWGYFPDTK TVDLWPEKEK KSYEGGIMTA MDKGSGTIAS    600
STSISYKMDD TDEHNLQKGL EKVLRILAAA GAEEIGTHHN EGKTLKVKQV SYHEFERFVK    660
EESARPIKGQ STPICSAHQM GSCRMGPNPR SSVVNPMGET WEVEGLYVAD TSVFPTALGV    720
NPMVTVQAIA YCTAQSVLEA LRRKKSRH*                                      780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK02106PRK021069.0e-767871639+
COG2303BetA2.0e-9315569301+
COG2303BetA4.0e-1667674065+
pfam05199GMC_oxred_C1.0e-23606731126+
pfam00732GMC_oxred_N5.0e-64339559224+
Gene Ontology
GO TermDescription
GO:0016614oxidoreductase activity, acting on CH-OH group of donors
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI29206.101974111644unnamed protein product [Vitis vinifera]
RefSeqNP_193673.20487451726alcohol oxidase-related [Arabidopsis thaliana]
RefSeqXP_002269629.101974511787PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002328753.10487481748predicted protein [Populus trichocarpa]
RefSeqXP_002519938.10957467710electron carrier, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1kdg_B0.0000042935629288A Chain A, Crystal Structure Of The Flavin Domain Of Cellobiose Dehydrogenase
PDB1kdg_A0.0000042935629288A Chain A, Crystal Structure Of The Flavin Domain Of Cellobiose Dehydrogenase
PDB1naa_B0.0000042935624283A Chain A, Cellobiose Dehydrogenase Flavoprotein Fragment In Complex With Cellobionolactam
PDB1naa_A0.0000042935624283A Chain A, Cellobiose Dehydrogenase Flavoprotein Fragment In Complex With Cellobionolactam
PDB3gdp_B0.00229355828299A Chain A, Cellobiose Dehydrogenase Flavoprotein Fragment In Complex With Cellobionolactam
Transmembrane Domains
StartEnd
109128
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES59175225812570
ES5922962402024410
DC8838502533395910
DC8838501416067460
EY8046732523155660
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_089_00009.1Aquca_049_00132.1Aquca_034_00307.1Aquca_034_00304.1
Arabidopsis lyrata914728491906479855470376
Arabidopsis thalianaAT4G19380.1AT4G28570.1AT3G23410.1AT1G03990.1
Brachypodium distachyonBradi3g28677.1Bradi3g28657.1Bradi3g49085.1
Brassica rapaBra012548Bra024190Bra013391Bra015283Bra001912
Bra014947
Carica papayaevm.model.supercontig_165.33evm.model.supercontig_44.31evm.model.supercontig_2124.1
Capsella rubellaCarubv10004418mCarubv10004208mCarubv10012453mCarubv10004212mCarubv10013046m
Citrus clementinaCiclev10011111mCiclev10004403mCiclev10004405mCiclev10018992m
Citrus sinensisorange1.1g003990morange1.1g004496m
Cucumis sativusCucsa.037200.2Cucsa.037200.1Cucsa.035240.1Cucsa.255570.1
Eucalyptus grandisEucgr.H03017.2Eucgr.H03017.1Eucgr.H00753.1Eucgr.K02114.1Eucgr.D02568.1
Fragaria vescamrna08288.1-v1.0-hybridmrna11513.1-v1.0-hybridmrna08285.1-v1.0-hybrid
Glycine maxGlyma09g35210.2Glyma01g35620.1Glyma16g16415.1Glyma16g08300.2Glyma10g32640.2
Glyma12g15940.1Glyma19g34960.1Glyma06g42400.2Glyma03g32220.2
Gossypium raimondiiGorai.001G179800.3Gorai.001G179800.2Gorai.001G179800.1Gorai.011G177100.3Gorai.011G177100.2
Gorai.011G177100.1Gorai.006G252500.1
Linum usitatissimumLus10003621Lus10024922Lus10035673Lus10008239Lus10022903
Lus10037257Lus10011800
Malus domesticaMDP0000233110MDP0000173300MDP0000208936MDP0000197715
Manihot esculentacassava4.1_004067mcassava4.1_002349mcassava4.1_002619mcassava4.1_002379mcassava4.1_025870m
Medicago truncatulaMedtr5g025650.1Medtr8g072210.1Medtr4g081080.1Medtr1g075650.1Medtr4g080890.1
Mimulus guttatusmgv1a001761mmgv1a022390mmgv1a001868mmgv1a001883mmgv1a001896m
Oryza sativaLOC_Os10g33540.1LOC_Os10g33520.1LOC_Os10g33460.1LOC_Os02g40840.1
Panicum virgatumPavirv00054947m
Physcomitrella patensPp1s58_61V6.1Pp1s7_216V6.1Pp1s48_250V6.1Pp1s2_413V6.1
Phaseolus vulgarisPhvul.002G122600.1Phvul.003G278200.1Phvul.007G124200.1Phvul.001G162800.1Phvul.011G136600.1
Picea abiesMA_10427118g0010MA_9032943g0010MA_9483g0010MA_10427421g0010MA_242814g0010
Populus trichocarpaPotri.004G234900.2Potri.004G234900.1Potri.010G069100.1Potri.008G169300.1Potri.002G259700.1
Prunus persicappa014756mppa018458mppa021498m
Ricinus communis29827.m00265529981.m00058628492.m000467
Setaria italicaSi034362mSi034354mSi034359mSi016380m
Selaginella moellendorffii1140891168557460173531
Sorghum bicolorSb01g019470.1Sb01g019460.1Sb01g019480.1Sb04g026370.1Sb04g026390.1
Thellungiella halophilaThhalv10024717mThhalv10024496mThhalv10024528mThhalv10020141mThhalv10006882m
Vitis viniferaGSVIVT01036891001GSVIVT01027855001GSVIVT01028371001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)