y PlantCAZyme

CAZyme Information

Basic Information
SpeciesEucalyptus grandis
Cazyme IDEucgr.F00025.1
FamilyCE10
Protein PropertiesLength: 501 Molecular Weight: 55681.4 Isoelectric Point: 6.4363
ChromosomeChromosome/Scaffold: 6 Start: 660366 End: 666510
Descriptionalpha/beta-Hydrolases superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE102604734.9e-24
  SQEEKPPLLLKSHGGPTRKTRGVLNLSIQYWTSRGWAFVDVNYGGSTGYGREFRERLLGCWGIVDVDDCCSCAEFLVESRKVDGNRLCITGVSAGGYTTL
  AALAFRETFRAGASLYGVMNMLKAEPHKFESHYLDNFVVSEKDCYERSPINFVEKFSCPMILFQGLEDKVVPPDQGRKIYAALKQKGLPVALVEYEGEQH
  GFRKAENIKFTLEQ
Full Sequence
Protein Sequence     Length: 501     Download
MALGSPPSPP NIVSGASKRL GGISVDGEGC LIWLESRPNE AGRSVLVKEP EKPGDEPVDI    60
TPKEFAVRTA CHEYGGGAFC ISGDTHVFSN YKDQRLYKQS LHLKESLPLP ITPDYGGPSV    120
CYADGRFYKR LCVAGHNPKH VESPTEPKWS PEGELFFITD RQNGFWNLYK WKTLIACSYR    180
QMGRSHLAII DVLQSSLVSL DIPFTDIQDI TAGNNCLYIE GASGVLPTSV AKLIEFPTIV    240
PGQNAYAYFY PPSNHFYQAS QEEKPPLLLK SHGGPTRKTR GVLNLSIQYW TSRGWAFVDV    300
NYGGSTGYGR EFRERLLGCW GIVDVDDCCS CAEFLVESRK VDGNRLCITG VSAGGYTTLA    360
ALAFRETFRA GASLYGVMNM LKAEPHKFES HYLDNFVVSE KDCYERSPIN FVEKFSCPMI    420
LFQGLEDKVV PPDQGRKIYA ALKQKGLPVA LVEYEGEQHG FRKAENIKFT LEQQMLFFAR    480
LVGRFDVADE ITPIKIDNLD *                                              540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam12695Abhydrolase_52.0e-6288456169+
COG1505COG15051.0e-6248460226+
COG0412COG04122.0e-8303461163+
pfam00326Peptidase_S95.0e-45287483204+
COG1506DAP21.0e-55124485375+
Gene Ontology
GO TermDescription
GO:0006508proteolysis
GO:0008236serine-type peptidase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002284264.13.99931e-42713121145PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002284264.10124500226675PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002302446.11.4013e-45713127152predicted protein [Populus trichocarpa]
RefSeqXP_002302446.10124500233672predicted protein [Populus trichocarpa]
RefSeqXP_002510270.10124499282730acylamino-acid-releasing enzyme, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3azo_B0124483227649A Chain A, Crystal Structure Of Puromycin Hydrolase
PDB3azo_B0.0083311338122A Chain A, Crystal Structure Of Puromycin Hydrolase
PDB3azo_A0124483227649A Chain A, Crystal Structure Of Puromycin Hydrolase
PDB3azo_A0.0083311338122A Chain A, Crystal Structure Of Puromycin Hydrolase
PDB3azq_B0124483227649A Chain A, Crystal Structure Of Puromycin Hydrolase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7802164231535010
ES3053772622425010
FD4193752692294950
CX0473672532515010
HO780216331251570.007
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00583.4Aquca_017_00583.3Aquca_017_00583.2Aquca_017_00583.1Aquca_015_00163.1
Arabidopsis lyrata915409859721
Arabidopsis thalianaAT4G14570.1AT5G36210.1
Brachypodium distachyonBradi3g26780.4Bradi3g26780.3Bradi3g26780.2Bradi3g26787.1Bradi1g45890.1
Brassica rapaBra039731Bra036867Bra037063Bra030822
Capsella rubellaCarubv10006608mCarubv10013057mCarubv10012695mCarubv10013077mCarubv10004231m
Chlamydomonas reinhardtiiCre05.g241650.t1.3Cre10.g423300.t1.1
Citrus clementinaCiclev10004377mCiclev10004325mCiclev10003676m
Citrus sinensisorange1.1g005093morange1.1g004149morange1.1g004141morange1.1g003363morange1.1g004816m
orange1.1g004757morange1.1g004756morange1.1g004735m
Cucumis sativusCucsa.386660.1Cucsa.123480.1Cucsa.123460.1
Eucalyptus grandisEucgr.H00222.1Eucgr.H00221.1Eucgr.F00026.5Eucgr.F00026.4Eucgr.F00026.3
Eucgr.F00026.2Eucgr.F00026.1Eucgr.F00028.1Eucgr.F00027.2Eucgr.F00027.1
Eucgr.L02208.1Eucgr.F00027.3
Fragaria vescamrna29072.1-v1.0-hybridmrna32579.1-v1.0-hybridmrna09045.1-v1.0-hybridmrna09044.1-v1.0-hybrid
Glycine maxGlyma10g00350.1Glyma10g00320.1Glyma08g42730.1Glyma18g11480.3Glyma18g11480.2
Glyma18g11480.4
Gossypium raimondiiGorai.006G245500.5Gorai.006G245500.4Gorai.006G245500.3Gorai.006G245500.1Gorai.010G016900.1
Linum usitatissimumLus10039405Lus10015363Lus10032765Lus10021758
Malus domesticaMDP0000211874MDP0000304250MDP0000251803
Manihot esculentacassava4.1_002075mcassava4.1_031105mcassava4.1_005468m
Medicago truncatulaAC233668_48.1Medtr5g042400.2Medtr5g042400.1Medtr5g042410.1Medtr3g051310.1
Mimulus guttatusmgv1a001402mmgv1a001397mmgv1a002403m
Oryza sativaLOC_Os10g28020.3LOC_Os10g28020.1LOC_Os10g28020.2LOC_Os10g28030.2LOC_Os10g28030.1
LOC_Os06g11180.1
Panicum virgatumPavirv00008779mPavirv00061808mPavirv00015591mPavirv00045661mPavirv00003810m
Pavirv00003809m
Physcomitrella patensPp1s619_3V6.1Pp1s97_68V6.1Pp1s108_134V6.1Pp1s9_317V6.2Pp1s9_317V6.1
Pp1s139_36V6.2Pp1s139_36V6.1
Phaseolus vulgarisPhvul.007G279900.1Phvul.007G280000.1Phvul.006G042600.1Phvul.006G042700.1
Populus trichocarpaPotri.008G160400.1Potri.002G128700.9Potri.002G128700.8Potri.002G128700.7Potri.002G128700.6
Potri.002G128700.5Potri.002G128700.4Potri.002G128700.3Potri.002G128700.2Potri.002G128700.10
Potri.002G128700.1
Prunus persicappa001729mppa002365m
Ricinus communis29844.m00318230170.m01392428323.m000042
Setaria italicaSi034264mSi034356mSi006001mSi005937mSi005954m
Selaginella moellendorffii16830378836
Sorghum bicolorSb01g021970.4Sb01g021970.2Sb01g021970.1Sb01g021970.5Sb01g021960.1
Sb01g021970.3Sb10g007280.1Sb10g007270.1
Thellungiella halophilaThhalv10024477mThhalv10003712m
Vitis viniferaGSVIVT01018091001GSVIVT01009564001GSVIVT01009565001
Volvox carteriVocar20006950m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)