Basic Information | |
---|---|
Species | Eucalyptus grandis |
Cazyme ID | Eucgr.F00349.1 |
Family | GT1 |
Protein Properties | Length: 120 Molecular Weight: 12946 Isoelectric Point: 4.4611 |
Chromosome | Chromosome/Scaffold: 6 Start: 4743763 End: 4744122 |
Description | UDP-Glycosyltransferase superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT1 | 8 | 119 | 4.8e-27 |
CLEWLDLKPPGSVVYVNFGSITVMSQAQLVEFAWGLASSGQVFLWAIRPDLVVGDAAILPPDFLVATRERSLLVSWCPQERVLSHSAVGGFLTHCGWNST IESIATGVPVVC |
Full Sequence |
---|
Protein Sequence Length: 120 Download |
MWKEDLGCLE WLDLKPPGSV VYVNFGSITV MSQAQLVEFA WGLASSGQVF LWAIRPDLVV 60 GDAAILPPDF LVATRERSLL VSWCPQERVL SHSAVGGFLT HCGWNSTIES IATGVPVVC* 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN03004 | PLN03004 | 4.0e-33 | 4 | 118 | 121 | + UDP-glycosyltransferase | ||
PLN02448 | PLN02448 | 2.0e-33 | 4 | 116 | 113 | + UDP-glycosyltransferase family protein | ||
PLN03007 | PLN03007 | 3.0e-34 | 8 | 118 | 113 | + UDP-glucosyltransferase family protein | ||
PLN02410 | PLN02410 | 5.0e-36 | 1 | 119 | 121 | + UDP-glucoronosyl/UDP-glucosyl transferase family protein | ||
PLN02555 | PLN02555 | 9.0e-42 | 8 | 119 | 115 | + limonoid glucosyltransferase |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0008152 | metabolic process |
GO:0016758 | transferase activity, transferring hexosyl groups |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
DDBJ | BAF02177.1 | 0 | 1 | 119 | 6 | 124 | putative UDP-glucose glucosyltransferase [Arabidopsis thaliana] |
RefSeq | NP_564170.1 | 0 | 1 | 119 | 105 | 223 | AtUGT85A5 (UDP-glucosyl transferase 85A5); glucuronosyltransferase/ transferase, transferring glycosyl groups [Arabidopsis thaliana] |
RefSeq | XP_002285772.1 | 0 | 1 | 119 | 254 | 372 | PREDICTED: hypothetical protein isoform 2 [Vitis vinifera] |
RefSeq | XP_002285782.1 | 0 | 1 | 119 | 257 | 375 | PREDICTED: hypothetical protein isoform 2 [Vitis vinifera] |
RefSeq | XP_002513939.1 | 0 | 1 | 119 | 177 | 295 | UDP-glucuronosyltransferase, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2pq6_A | 0 | 1 | 119 | 278 | 396 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 2vg8_A | 1e-30 | 4 | 119 | 254 | 382 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 2vch_A | 1e-30 | 4 | 119 | 254 | 382 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 2vce_A | 1e-30 | 4 | 119 | 254 | 382 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
PDB | 2c9z_A | 4e-27 | 7 | 119 | 260 | 368 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EV186800 | 119 | 1 | 119 | 0 |
FD537169 | 119 | 1 | 119 | 0 |
EG509877 | 119 | 1 | 119 | 0 |
EY934664 | 119 | 1 | 119 | 0 |
EE255097 | 119 | 1 | 119 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|