Basic Information | |
---|---|
Species | Eucalyptus grandis |
Cazyme ID | Eucgr.H00320.1 |
Family | GH19 |
Protein Properties | Length: 177 Molecular Weight: 19293.2 Isoelectric Point: 4.3833 |
Chromosome | Chromosome/Scaffold: 8 Start: 4430754 End: 4431668 |
Description | homolog of carrot EP3-3 chitinase |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH19 | 10 | 176 | 0 |
SGYTEFGAVGTADDSKREIAAFFAHVTHETGHFCYIEEIDGPSEDYCDEWNIQYPCNPNKGYYGRGPIQISWNSNYGPAGESIGFDGLNSPETTANDVVV SFKTAFWFWMNNAHSIITSGQGFGATIRAINGIECGGGNPDAVQARVQYYIDYCNHCGVSPGDNLTC |
Full Sequence |
---|
Protein Sequence Length: 177 Download |
MRNLYPRVAS GYTEFGAVGT ADDSKREIAA FFAHVTHETG HFCYIEEIDG PSEDYCDEWN 60 IQYPCNPNKG YYGRGPIQIS WNSNYGPAGE SIGFDGLNSP ETTANDVVVS FKTAFWFWMN 120 NAHSIITSGQ GFGATIRAIN GIECGGGNPD AVQARVQYYI DYCNHCGVSP GDNLTC* 180 |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
COG3179 | COG3179 | 0.001 | 23 | 118 | 127 | + Predicted chitinase [General function prediction only] |
cd00442 | lysozyme_like | 2.0e-8 | 64 | 142 | 79 | + lysozyme_like domain. This contains several members including Soluble Lytic Transglycosylases (SLT), Goose Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, and chitosanases. All the members are involved in the hydrolysis of beta-1,4- linked polysaccharides. |
pfam00182 | Glyco_hydro_19 | 8.0e-76 | 9 | 176 | 199 | + Chitinase class I. |
cd00325 | chitinase_glyco_hydro_19 | 5.0e-84 | 9 | 176 | 198 | + Glycoside hydrolase family 19 chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases but they are smaller in size due to certain deletions. Despite any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the procaryotic/eucaryotic divergence. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004568 | chitinase activity |
GO:0006032 | chitin catabolic process |
GO:0016998 | cell wall macromolecule catabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABJ74186.1 | 0 | 2 | 176 | 38 | 217 | chitinase-like protein [Artemisia annua] |
GenBank | ACM45716.1 | 0 | 2 | 176 | 99 | 272 | class IV chitinase [Pyrus pyrifolia] |
EMBL | CAN79256.1 | 0 | 2 | 176 | 94 | 266 | hypothetical protein [Vitis vinifera] |
EMBL | CBI24654.1 | 0 | 2 | 176 | 37 | 209 | unnamed protein product [Vitis vinifera] |
RefSeq | XP_002274905.1 | 0 | 2 | 176 | 95 | 267 | PREDICTED: hypothetical protein isoform 1 [Vitis vinifera] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3hbh_A | 0 | 3 | 176 | 31 | 204 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
PDB | 3hbe_X | 0 | 3 | 176 | 31 | 204 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
PDB | 3hbd_A | 0 | 3 | 176 | 31 | 204 | A Chain A, Class Iv Chitinase Structure From Picea Abies At 1.8a |
PDB | 4dyg_B | 3.00004e-41 | 8 | 176 | 38 | 237 | A Chain A, Class Iv Chitinase Structure From Picea Abies At 1.8a |
PDB | 4dyg_A | 3.00004e-41 | 8 | 176 | 38 | 237 | A Chain A, Class Iv Chitinase Structure From Picea Abies At 1.8a |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DT042757 | 177 | 2 | 177 | 0 |
EB122920 | 177 | 2 | 177 | 0 |
EY093227 | 182 | 2 | 177 | 0 |
EY101526 | 182 | 2 | 177 | 0 |
ES433830 | 177 | 2 | 177 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|