CAZyme Information

Basic Information
SpeciesEucalyptus grandis
Cazyme IDEucgr.H03669.1
FamilyAA2
Protein PropertiesLength: 237 Molecular Weight: 25946.4 Isoelectric Point: 5.7372
ChromosomeChromosome/Scaffold: 8 Start: 53808724 End: 53810226
DescriptionPeroxidase superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2482275.1e-26
  PNRSLEGLDVIDEIKAELEAECPLTVSCANILVLAARDGGVLTGRRDERVSLASEALDNLPSPASDFNTLQQQFADNGQGVPDLVVLSVAHTIGVAHCVV
  FAKRLFNFTGNNDTDASLDPGYTATLKAQCSSPRNTVGLDPNSSSSFDSHYFVVLFRNQGLLTSDVTLLMDKRAANFAWI
Full Sequence
Protein Sequence     Length: 237     Download
MTFYRESCPR AEAIVRNITW SRVAANPALP AKILRLQFRD CFVRDTIPNR SLEGLDVIDE    60
IKAELEAECP LTVSCANILV LAARDGGVLT GRRDERVSLA SEALDNLPSP ASDFNTLQQQ    120
FADNGQGVPD LVVLSVAHTI GVAHCVVFAK RLFNFTGNND TDASLDPGYT ATLKAQCSSP    180
RNTVGLDPNS SSSFDSHYFV VLFRNQGLLT SDVTLLMDKR AANFAWIYRK FNVFLA*       240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00691ascorbate_peroxidase0.00891230148+
cd00314plant_peroxidase_like2.0e-721220253+
pfam00141peroxidase4.0e-3515140150+
PLN03030PLN030303.0e-583224252+
cd00693secretory_peroxidase2.0e-1001224254+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABM66586.10322330281putative peroxidase [Cinnamomum micranthum f. kanehirae]
GenBankABQ18321.10322330281putative peroxidase [Cinnamomum micranthum f. kanehirae]
GenBankABQ23446.10322330281putative peroxidase [Cinnamomum micranthum f. kanehirae]
RefSeqXP_002516845.10123630295Peroxidase 27 precursor, putative [Ricinus communis]
RefSeqXP_002516846.10723558317Peroxidase 24 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3hdl_A1.00053e-4232186254A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
PDB1qgj_B9.99995e-4132236253A Chain A, Arabidopsis Thaliana Peroxidase N
PDB1qgj_A9.99995e-4132236253A Chain A, Arabidopsis Thaliana Peroxidase N
PDB1sch_B3e-3832166243A Chain A, Peanut Peroxidase
PDB1sch_A3e-3832166243A Chain A, Peanut Peroxidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DR91935026612350
DN79897225332230
CX66733525332230
DY30668625632260
FC91856124232120
Orthologous Group
SpeciesID
Brassica rapaBra008715
Carica papayaevm.model.supercontig_16.92evm.model.supercontig_2186.1
Citrus sinensisorange1.1g041339m
Eucalyptus grandisEucgr.L01603.1Eucgr.H03668.1
Malus domesticaMDP0000572590
Mimulus guttatusmgv1a014238m
Panicum virgatumPavirv00056620mPavirv00020581mPavirv00056619mPavirv00054667mPavirv00057804m
Pavirv00055510mPavirv00021339m
Picea abiesMA_946965g0010MA_3930037g0010MA_10433598g0020MA_48212g0010MA_149004g0010
MA_142961g0010MA_7571130g0010MA_10431507g0030
Populus trichocarpaPotri.T106200.1
Ricinus communis29726.m003967
Setaria italicaSi003834m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny