y PlantCAZyme

CAZyme Information

Basic Information
SpeciesEucalyptus grandis
Cazyme IDEucgr.H04490.2
FamilyGH2
Protein PropertiesLength: 993 Molecular Weight: 112269 Isoelectric Point: 6.5113
ChromosomeChromosome/Scaffold: 8 Start: 64108011 End: 64115035
Descriptionglycoside hydrolase family 2 protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH2467620
  DPPWMEAVVPGTVLATLVKNKAVPDPFYGLNNEAIIDIADSGREHYTFWFFTTFQCKLPEAQHLDLNFRAINYSAEVYLNGNKKVLPKGMFRRHQLDVTD
  ILHPNGQNMLAVLVHPPDHPGKIPPEGGQGGDHEIGKDVATQYVQGWDWMAPIRDRNTGIWDEVSVSVTGPVKLIDPHLVSSFFDNYKRVYLHCTTELEN
  RSTRVAECSLSIEVTAELEGNFTLIEHLRTEHRSISPGARSQHTFTELFFYKPNLWWPNGMGKQSLYHVAISVEVKGFGESDSWRHLFGFRKIESHIDSA
  TGGRLFKVNGQPIFIRGGNWILSDGLLRLSEKRYETDIKFHADMNFNMIRCWGGGLAERPEFYRYCDMYGLLVWQEFWITGDVDGRGDPVSNPDGPLDHD
  LFLLCARDTVKLLRNHASLALWVGGNEQVPPVDLNTALKDYLKLHPYFEKVDEHDKILEDLNNEEEDPSLYLDGTRIYVQGSMWDGFADSKGGWTDGPYE
  IQYPESFFKDDFYNYGFNPEVGSVGVPVAATIRATMPPEGWQIPIFKKLPNGYTEEVPNPIWQYHKYIPYSKPDKVHDQIEVYGTPTDLDDFCLKAQLVN
  YVQYRALLEGWTSHMWRKFTGVLIWKTQNPWTGLRGQFYDHLLDQTAGFYGCRSAAEPIHVQLNLATYSIEVVNTTSDELSGIAIEASVWDLEGACPYYK
  VFDKLSVPPKKTVSIVE
Full Sequence
Protein Sequence     Length: 993     Download
MEAAVTPVIA GIGKTRFDSG WLAARSTEVE LTGAQLTTTH PPTGADPPWM EAVVPGTVLA    60
TLVKNKAVPD PFYGLNNEAI IDIADSGREH YTFWFFTTFQ CKLPEAQHLD LNFRAINYSA    120
EVYLNGNKKV LPKGMFRRHQ LDVTDILHPN GQNMLAVLVH PPDHPGKIPP EGGQGGDHEI    180
GKDVATQYVQ GWDWMAPIRD RNTGIWDEVS VSVTGPVKLI DPHLVSSFFD NYKRVYLHCT    240
TELENRSTRV AECSLSIEVT AELEGNFTLI EHLRTEHRSI SPGARSQHTF TELFFYKPNL    300
WWPNGMGKQS LYHVAISVEV KGFGESDSWR HLFGFRKIES HIDSATGGRL FKVNGQPIFI    360
RGGNWILSDG LLRLSEKRYE TDIKFHADMN FNMIRCWGGG LAERPEFYRY CDMYGLLVWQ    420
EFWITGDVDG RGDPVSNPDG PLDHDLFLLC ARDTVKLLRN HASLALWVGG NEQVPPVDLN    480
TALKDYLKLH PYFEKVDEHD KILEDLNNEE EDPSLYLDGT RIYVQGSMWD GFADSKGGWT    540
DGPYEIQYPE SFFKDDFYNY GFNPEVGSVG VPVAATIRAT MPPEGWQIPI FKKLPNGYTE    600
EVPNPIWQYH KYIPYSKPDK VHDQIEVYGT PTDLDDFCLK AQLVNYVQYR ALLEGWTSHM    660
WRKFTGVLIW KTQNPWTGLR GQFYDHLLDQ TAGFYGCRSA AEPIHVQLNL ATYSIEVVNT    720
TSDELSGIAI EASVWDLEGA CPYYKVFDKL SVPPKKTVSI VEMNYPKSQS PKPVYFLLLK    780
LYHMSDSGII SRNFYWLHVS GGNYKLLEAY RKKKVPLRIT SRAYVRGSTY EIDMHVQNTS    840
RRLNSQNLTY RNIFSRRHRV GDIDLASLGS DQAAKEVKRQ SGLLQGAAKC FSGLLQGAAK    900
CFLKEANSPS VAIINGTDVG VAFFLHFSVH AMKTDRKEGE DTRILPVHYS DNYFSLVPGE    960
IMTTKISFEV PPGVTPRVTL NGWNYHGGHT VH*                                 1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK09525lacZ2.0e-5334472156+
PRK10150PRK101502.0e-667472450+
pfam00703Glyco_hydro_26.0e-9217336120+
PRK10340ebgA4.0e-12121472367+
COG3250LacZ4.0e-3651695667+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAO27794.1099911975glycosyl hydrolase [Gossypium hirsutum]
EMBLCAN82620.1099921973hypothetical protein [Vitis vinifera]
RefSeqXP_002284576.1099921973PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002319539.1099921973predicted protein [Populus trichocarpa]
RefSeqXP_002512381.1099911972beta-mannosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vzo_B0879744767A Chain A, Crystal Structure Of Amycolatopsis Orientalis Exo- Chitosanase Csxa
PDB2vzo_A0879744767A Chain A, Crystal Structure Of Amycolatopsis Orientalis Exo- Chitosanase Csxa
PDB2x09_B0879744767A Chain A, Crystal Structure Of Amycolatopsis Orientalis Exo- Chitosanase Csxa
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES7939203823807570
FY7872222814207000
FY785066279743520
FY7941262772795550
FY78541227812780
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00437.1Aquca_017_00437.4Aquca_054_00086.1Aquca_017_00437.2Aquca_017_00437.5
Aquca_017_00437.3
Arabidopsis lyrata888134
Arabidopsis thalianaAT1G09010.1
Brachypodium distachyonBradi2g26600.1
Brassica rapaBra018587Bra030751
Carica papayaevm.model.supercontig_48.57
Capsella rubellaCarubv10008228m
Citrus clementinaCiclev10000150mCiclev10000160m
Citrus sinensisorange1.1g045314m
Cucumis sativusCucsa.182080.2Cucsa.182080.1
Eucalyptus grandisEucgr.H04490.1Eucgr.H04490.3
Fragaria vescamrna22540.1-v1.0-hybrid
Glycine maxGlyma10g29550.1Glyma20g37760.1Glyma03g39810.1Glyma19g42370.1
Gossypium raimondiiGorai.013G124100.1Gorai.007G297200.2Gorai.007G297200.1Gorai.007G297200.3Gorai.007G297200.4
Linum usitatissimumLus10029917Lus10004484
Malus domesticaMDP0000300462MDP0000144916MDP0000026514MDP0000210658
Manihot esculentacassava4.1_001014m
Medicago truncatulaMedtr7g113570.1Medtr1g082890.1
Mimulus guttatusmgv1a023381mmgv1a000882mmgv1a024358m
Oryza sativaLOC_Os05g32530.1
Panicum virgatumPavirv00050693mPavirv00063196mPavirv00063197m
Physcomitrella patensPp1s2985_1V6.1Pp1s99_248V6.1Pp1s114_165V6.1
Phaseolus vulgarisPhvul.007G180100.1Phvul.006G092100.1
Picea abiesMA_10427468g0010
Populus trichocarpaPotri.013G021200.4Potri.013G021200.3Potri.013G021200.1Potri.013G021200.2
Prunus persicappa000875mppa000882m
Ricinus communis30128.m008776
Setaria italicaSi021098m
Selaginella moellendorffii164536
Sorghum bicolorSb09g019350.1
Thellungiella halophilaThhalv10006730m
Vitis viniferaGSVIVT01000073001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny