y PlantCAZyme

CAZyme Information

Basic Information
SpeciesEucalyptus grandis
Cazyme IDEucgr.I02168.1
FamilyGT68
Protein PropertiesLength: 584 Molecular Weight: 65567.5 Isoelectric Point: 6.4668
ChromosomeChromosome/Scaffold: 9 Start: 31541206 End: 31544952
DescriptionO-fucosyltransferase family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT682655580
  GRILVVPSSKVDYEYNKVLDVDHINDCLGRKVVMSFEEFSGVKKTHLHIDRFICYFSSPQHCYVDDEHVKKLKGLGISMGKLESPWVEDTQKPNKRTIQD
  VEAKFTVDDDVIAIGDVFFADLEQEWVTQPGGPLAHKCKALIEPSHLIVLTAQRFIQTFLGKNYIALHFRRHGFLKFCNAKTPSCFYPVPQAAECIKRVV
  ERTDAPVIYLSTDAAESETGLLQTLIFSNGKPIPLVKRPDRSPAEKWDALLYRHGLQDDSQVEAMLDKTICAMSRVFIGASGSTFTEDILRLRK
Full Sequence
Protein Sequence     Length: 584     Download
MERDWSDEDD DSHHLIHQND TKPVSSSTSR RGRSAFDVED LDSRIGAARR FPFRFNKSYL    60
LAILISVLFL VAFFSADIRG LFSGHASAFG LGSTADRMRE SELRALSLLK QQRLGLFGLW    120
NHTFLDSAIA RNGTANFTLS SSNSSVLKKR DSGHLLASSS ALFEDFKSAV LRQIKLNKDI    180
EEVLLLPHQS GNVSVENGDG DMVDVNFSDF GFDQCRTVDQ NSSGRKTIEW KPKPDKFLLA    240
ICVSGQMSNH LICLEKHMFF AAVLGRILVV PSSKVDYEYN KVLDVDHIND CLGRKVVMSF    300
EEFSGVKKTH LHIDRFICYF SSPQHCYVDD EHVKKLKGLG ISMGKLESPW VEDTQKPNKR    360
TIQDVEAKFT VDDDVIAIGD VFFADLEQEW VTQPGGPLAH KCKALIEPSH LIVLTAQRFI    420
QTFLGKNYIA LHFRRHGFLK FCNAKTPSCF YPVPQAAECI KRVVERTDAP VIYLSTDAAE    480
SETGLLQTLI FSNGKPIPLV KRPDRSPAEK WDALLYRHGL QDDSQVEAML DKTICAMSRV    540
FIGASGSTFT EDILRLRKDW GSASRCDEYL CQGEEPNFIA DDE*                     600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd11302O-FucT-10.007406558179+
cd11296O-FucT_like0.000323727842+
pfam10250O-FucT7.0e-5260550326+
cd11298O-FucT-23.0e-10424550129+
cd11296O-FucT_like1.0e-17398557170+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM66093.1015831566unknown [Arabidopsis thaliana]
RefSeqNP_173170.2015831564unknown protein [Arabidopsis thaliana]
RefSeqNP_199853.1015831566unknown protein [Arabidopsis thaliana]
RefSeqXP_002264087.1015831559PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002303337.1015831527predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4ap6_D0.001424550277383A Chain A, Crystal Structure Of Human Pofut2 E54a Mutant In Complex With Gdp- Fucose
PDB4ap6_C0.001424550277383A Chain A, Crystal Structure Of Human Pofut2 E54a Mutant In Complex With Gdp- Fucose
PDB4ap6_B0.001424550277383A Chain A, Crystal Structure Of Human Pofut2 E54a Mutant In Complex With Gdp- Fucose
PDB4ap6_A0.001424550277383A Chain A, Crystal Structure Of Human Pofut2 E54a Mutant In Complex With Gdp- Fucose
PDB4ap5_B0.002424550263369A Chain A, Crystal Structure Of Human Pofut2
Transmembrane Domains
StartEnd
5981
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8818723532325810
ES8502683282245490
JK6414642373485840
CO0852392872815660
ES850268525305796.4
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_013_00900.1Aquca_013_00900.2
Arabidopsis lyrata918074889130474511
Arabidopsis thalianaAT5G50420.1AT1G17270.1AT1G53770.2AT1G53770.1
Brachypodium distachyonBradi1g23980.1
Brassica rapaBra039691Bra016609Bra022515
Carica papayaevm.model.supercontig_25.202
Capsella rubellaCarubv10008736mCarubv10026161mCarubv10008696m
Citrus clementinaCiclev10025289m
Citrus sinensisorange1.1g008526m
Cucumis sativusCucsa.088930.1Cucsa.149140.2Cucsa.088930.2Cucsa.149140.1
Eucalyptus grandisEucgr.J02587.1
Fragaria vescamrna05486.1-v1.0-hybrid
Glycine maxGlyma16g01730.1Glyma07g05200.1
Gossypium raimondiiGorai.010G172800.1Gorai.006G090800.1Gorai.011G054400.1
Linum usitatissimumLus10037461Lus10003929
Malus domesticaMDP0000692823MDP0000881647MDP0000203531
Manihot esculentacassava4.1_004684m
Medicago truncatulaMedtr8g023490.1
Mimulus guttatusmgv1a003863m
Oryza sativaLOC_Os07g38490.1
Panicum virgatumPavirv00005372mPavirv00007596m
Physcomitrella patensPp1s149_19V6.1
Phaseolus vulgarisPhvul.010G122400.1Phvul.009G261000.1
Picea abiesMA_10437033g0010
Populus trichocarpaPotri.003G073500.5Potri.003G073500.1Potri.003G073500.2Potri.003G073500.3Potri.003G073500.4
Potri.003G073500.6
Prunus persicappa004150m
Ricinus communis29884.m000188
Setaria italicaSi029376m
Selaginella moellendorffii146424410382
Sorghum bicolorSb02g037060.1
Thellungiella halophilaThhalv10013133mThhalv10007186mThhalv10011359m
Vitis viniferaGSVIVT01016658001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny