Basic Information | |
---|---|
Species | Eucalyptus grandis |
Cazyme ID | Eucgr.I02240.1 |
Family | GH19 |
Protein Properties | Length: 90 Molecular Weight: 9811.71 Isoelectric Point: 5.0201 |
Chromosome | Chromosome/Scaffold: 9 Start: 32419021 End: 32419371 |
Description | Chitinase family protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH19 | 2 | 89 | 2.2e-27 |
VSSIISRAQFDQLSSTERPGLPAKGFYTYDAFVAAARSFPGFGTTGTRDTRYREVTAFLAQTSHETTGGSKGAPDGPYAWGYCFVEER |
Full Sequence |
---|
Protein Sequence Length: 90 Download |
DVSSIISRAQ FDQLSSTERP GLPAKGFYTY DAFVAAARSF PGFGTTGTRD TRYREVTAFL 60 AQTSHETTGG SKGAPDGPYA WGYCFVEERE |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd00325 | chitinase_glyco_hydro_19 | 3.0e-37 | 6 | 89 | 85 | + Glycoside hydrolase family 19 chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases but they are smaller in size due to certain deletions. Despite any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the procaryotic/eucaryotic divergence. | ||
pfam00182 | Glyco_hydro_19 | 4.0e-40 | 5 | 89 | 86 | + Chitinase class I. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004568 | chitinase activity |
GO:0006032 | chitin catabolic process |
GO:0016998 | cell wall macromolecule catabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1DXJ | 5e-33 | 1 | 90 | 1 | 91 | A Chain A, Structure Of The Chitinase From Jack Bean |
PDB | 3CQL | 9e-36 | 2 | 90 | 2 | 91 | A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya |
EMBL | CAA07413.1 | 6e-33 | 1 | 90 | 29 | 119 | chitinase precursor [Canavalia ensiformis] |
Swiss-Prot | P85084 | 2e-35 | 2 | 90 | 2 | 91 | CHIT_CARPA RecName: Full=Endochitinase |
RefSeq | XP_002447824.1 | 2e-33 | 2 | 90 | 26 | 115 | hypothetical protein SORBIDRAFT_06g016510 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3cql_B | 1e-37 | 2 | 90 | 2 | 91 | A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya |
PDB | 3cql_A | 1e-37 | 2 | 90 | 2 | 91 | A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya |
PDB | 1dxj_A | 7e-35 | 1 | 90 | 1 | 91 | A Chain A, Structure Of The Chitinase From Jack Bean |
PDB | 4dyg_B | 3e-33 | 2 | 89 | 3 | 91 | A Chain A, Structure Of The Chitinase From Jack Bean |
PDB | 4dyg_A | 3e-33 | 2 | 89 | 3 | 91 | A Chain A, Structure Of The Chitinase From Jack Bean |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
HS061989 | 91 | 1 | 90 | 0 |
FY794204 | 91 | 1 | 90 | 0 |
FY793214 | 91 | 1 | 90 | 0 |
HS059877 | 91 | 1 | 90 | 0 |
HS057112 | 91 | 1 | 90 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|