Basic Information | |
---|---|
Species | Eucalyptus grandis |
Cazyme ID | Eucgr.I02269.1 |
Family | GH19 |
Protein Properties | Length: 135 Molecular Weight: 14629.1 Isoelectric Point: 6.7578 |
Chromosome | Chromosome/Scaffold: 9 Start: 33254836 End: 33255357 |
Description | basic chitinase |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH19 | 28 | 133 | 1.4e-33 |
SSHRNDQACPAKGFYTYDAFVAIARSFPGFGTTDTWDTRYQEVAAFLAQTSHEITGGSKGAPDGHYAWGYCFVEERDRSRDYCDPQSGWLSAPGRKYYGR GPIQIS |
Full Sequence |
---|
Protein Sequence Length: 135 Download |
MRSLWAVALL ASCLAVLSAS AQQGGDASSH RNDQACPAKG FYTYDAFVAI ARSFPGFGTT 60 DTWDTRYQEV AAFLAQTSHE ITGGSKGAPD GHYAWGYCFV EERDRSRDYC DPQSGWLSAP 120 GRKYYGRGPI QISQ* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd00325 | chitinase_glyco_hydro_19 | 2.0e-45 | 30 | 133 | 104 | + Glycoside hydrolase family 19 chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases but they are smaller in size due to certain deletions. Despite any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the procaryotic/eucaryotic divergence. | ||
pfam00182 | Glyco_hydro_19 | 1.0e-50 | 30 | 133 | 104 | + Chitinase class I. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004568 | chitinase activity |
GO:0006032 | chitin catabolic process |
GO:0016998 | cell wall macromolecule catabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3CQL | 5.99756e-43 | 30 | 133 | 17 | 120 | A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya |
GenBank | AAF69768.1 | 1.99965e-42 | 20 | 133 | 54 | 167 | AF135128_1 class I chitinase [Arabis alpina] |
GenBank | ABB89767.1 | 1.00053e-42 | 29 | 133 | 85 | 189 | At3g12500-like protein [Boechera stricta] |
DDBJ | BAH28788.1 | 1.00053e-42 | 1 | 133 | 1 | 140 | class II chitinase [Vaccinium corymbosum] |
Swiss-Prot | Q9FRV1 | 1.00053e-42 | 30 | 134 | 95 | 199 | CHIA_SECCE RecName: Full=Basic endochitinase A; AltName: Full=Rye seed chitinase-a; Short=RSC-a; Flags: Precursor |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3cql_B | 9.80909e-45 | 30 | 133 | 17 | 120 | A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya |
PDB | 3cql_A | 9.80909e-45 | 30 | 133 | 17 | 120 | A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya |
PDB | 4dyg_B | 7.00649e-44 | 30 | 134 | 18 | 122 | A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya |
PDB | 4dyg_A | 7.00649e-44 | 30 | 134 | 18 | 122 | A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya |
PDB | 4dwx_B | 7.00649e-44 | 30 | 134 | 18 | 122 | A Chain A, Crystal Structure Of A Family Gh-19 Chitinase From Rye Seeds |