y PlantCAZyme

CAZyme Information

Basic Information
SpeciesEucalyptus grandis
Cazyme IDEucgr.I02332.1
FamilyGH35
Protein PropertiesLength: 823 Molecular Weight: 92286.1 Isoelectric Point: 9.6775
ChromosomeChromosome/Scaffold: 9 Start: 33837185 End: 33841750
Descriptionglycosyl hydrolase family 35 protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH35363400
  LIINGSRELLFSGSIHYPRSTPEMWGDILHKAKKGGLNVIQTYVFWNVHEPVQGQYNFNGNYDLVKFIKMIGKLGMYATLRVGPFIEAEWNFGGFPYWLR
  EVPNITFRTDNEPFKYHMKKFTKVIIKKMKDEKLFASQGGPIILSQIENEYTNVQLAYKMLGTRYIQWAGKMAVGLKTGVPWVMCMQKDAPDPVINACNG
  RNCGDTFTGPNSPNKPRLWTENWTAQYRVFGDPPSQRSAEDLAYSVARFFSKNGTLANYYMYYGGTNFGRTPSSFVTTRYYDEAPIDEYGLLREPKWGHL
  RDLHS
Full Sequence
Protein Sequence     Length: 823     Download
MLKLGQVFLA ALLAFISVLS AVADKAPGVT YDARSLIING SRELLFSGSI HYPRSTPEMW    60
GDILHKAKKG GLNVIQTYVF WNVHEPVQGQ YNFNGNYDLV KFIKMIGKLG MYATLRVGPF    120
IEAEWNFGGF PYWLREVPNI TFRTDNEPFK YHMKKFTKVI IKKMKDEKLF ASQGGPIILS    180
QIENEYTNVQ LAYKMLGTRY IQWAGKMAVG LKTGVPWVMC MQKDAPDPVI NACNGRNCGD    240
TFTGPNSPNK PRLWTENWTA QYRVFGDPPS QRSAEDLAYS VARFFSKNGT LANYYMYYGG    300
TNFGRTPSSF VTTRYYDEAP IDEYGLLREP KWGHLRDLHS ALRLCKKALL WGTPTVQNLG    360
EGLEAQVYEK PGTGICAAFL SNNSTRLPRQ VMFKGIEYYL PQRSISILVD CKTVVYNTGT    420
VVSQHSSRKY HQSEIANKNL RWEMWRDNIP TTSDAPIKSK SPLELMSTTK DTTDYLWYAT    480
SIKLYPTDLP FRKDIIPVLQ VANLGHLMHA FVNGEYIGSG HGSNIEKSFV LQKPIELKPG    540
LNNISLLSAT VGLPDSGAYM EHRFAGVHKV TLKGLNTGTL DLSLNGWAHK VGLDGEKLHV    600
YRQGGSHRVQ WTKAKKHGQP LTWYKAYFDA PEGNDPVVMQ LGTMSKGMAW VNGKSIGRYW    660
SSYLSPLERP SQDVYHVPRA FLKPTDNLLV LLEEIGGNPE GVKILTVSRD VVCSFIHERD    720
PVTVKSWKTN GGLIRTVADD MKPRAHLQCP EDKKIVKVEF ASYGNPFGAC GSYGVGNCSA    780
AKSQKVVEQR CLGRSKCSVK VERKNFDKAG SLCPDVLKML AVQ                      840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02449Glyco_hydro_422.0e-55113485+
pfam02140Gal_Lectin2.0e-1774782381+
COG1874LacA2.0e-1829188170+
pfam01301Glyco_hydro_352.0e-14735342322+
PLN03059PLN0305907823844+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005529Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates." [CHEBI:16646, GOC:mah]
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAS76480.102382343839beta-galactosidase [Gossypium hirsutum]
GenBankACC60982.102182320823beta-galactosidase 2 precursor [Petunia x hybrida]
RefSeqXP_002278545.1018231826PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002306183.102182323823predicted protein [Populus trichocarpa]
RefSeqXP_002312963.1018231822predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3thd_D1e-382933811330A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya
PDB3thd_D0.006455722373634A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya
PDB3thd_C1e-382933811330A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya
PDB3thd_C0.006455722373634A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya
PDB3thd_B1e-382933811330A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya
Signal Peptide
Cleavage Site
21
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO778160700297040
HO780602594796650
HO7955525301196410
HO7955527712880
HO79555240801190
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00260.2Aquca_014_00260.1Aquca_006_00263.3Aquca_006_00263.2Aquca_006_00263.1
Arabidopsis lyrata496568476906491156480556912308
Arabidopsis thalianaAT5G63800.1AT1G77410.1AT4G38590.2AT4G38590.1AT2G16730.1
AT4G35010.1
Brachypodium distachyonBradi2g56597.1Bradi3g42330.1Bradi4g36517.1Bradi2g24670.1
Brassica rapaBra029200Bra011577Bra017687Bra013052Bra001991
Bra033571Bra024237
Carica papayaevm.model.supercontig_37.29evm.model.supercontig_64.121evm.model.supercontig_64.120evm.model.supercontig_37.144
Capsella rubellaCarubv10028665mCarubv10022317mCarubv10007813mCarubv10006573mCarubv10016129m
Citrus clementinaCiclev10000420mCiclev10004034mCiclev10003478mCiclev10023501mCiclev10026929m
Ciclev10030124m
Citrus sinensisorange1.1g003612morange1.1g041957morange1.1g045037morange1.1g035496morange1.1g006326m
orange1.1g006301m
Cucumis sativusCucsa.060550.1Cucsa.370570.1
Eucalyptus grandisEucgr.H05090.1Eucgr.G01775.1Eucgr.I01412.1
Fragaria vescamrna24180.1-v1.0-hybridmrna11229.1-v1.0-hybridmrna06055.1-v1.0-hybridmrna07651.1-v1.0-hybrid
Glycine maxGlyma06g16430.1Glyma04g38580.3Glyma08g00470.1Glyma04g38580.1Glyma04g38580.2
Glyma08g00470.2Glyma04g42620.3Glyma06g12150.1Glyma04g42620.2Glyma06g12150.2
Glyma12g03650.1Glyma12g03650.2Glyma04g00520.1Glyma11g11500.1
Gossypium raimondiiGorai.012G037700.1Gorai.010G052200.1Gorai.010G052300.1Gorai.009G265200.1Gorai.002G197200.3
Gorai.002G197200.2Gorai.002G197200.1Gorai.002G197100.1Gorai.008G036000.1
Linum usitatissimumLus10020875.306.587Lus10020875.306.587Lus10028538Lus10033502Lus10033427
Lus10018138Lus10008259Lus10033500Lus10020875.38.306Lus10020875.38.306
Lus10014126Lus10019784Lus10005071Lus10027844Lus10027843
Malus domesticaMDP0000202466MDP0000316304MDP0000243780MDP0000206284MDP0000322037
MDP0000320504MDP0000225967MDP0000222132MDP0000863563
Manihot esculentacassava4.1_033913mcassava4.1_025630mcassava4.1_023088mcassava4.1_031197mcassava4.1_023181m
cassava4.1_023219m
Medicago truncatulaMedtr3g096910.1Medtr8g095690.1Medtr3g088520.1Medtr3g117840.1Medtr4g073290.1
Mimulus guttatusmgv1a018569mmgv1a001345m
Oryza sativaLOC_Os05g35360.1LOC_Os08g43570.1LOC_Os09g36810.1
Panicum virgatumPavirv00062685mPavirv00037142mPavirv00063105mPavirv00038064mPavirv00037143m
Pavirv00021342mPavirv00010263mPavirv00038026mPavirv00010484m
Phaseolus vulgarisPhvul.009G153000.1Phvul.009G127500.1Phvul.009G119400.1Phvul.L007600.1Phvul.009G119600.1
Phvul.011G035300.1
Picea abiesMA_65469g0020
Populus trichocarpaPotri.005G069200.2Potri.005G069200.1Potri.005G180600.1Potri.002G080700.1Potri.013G105100.1
Potri.009G134400.1Potri.004G174800.1
Prunus persicappa001308mppa019277mppa026900mppa020492m
Ricinus communis29648.m00200830074.m001370
Setaria italicaSi004751mSi021244mSi024535mSi013260mSi028962m
Sorghum bicolorSb09g021140.1Sb07g024870.1Sb02g031260.1
Thellungiella halophilaThhalv10018129mThhalv10005464mThhalv10024392mThhalv10022550m
Vitis viniferaGSVIVT01022353001GSVIVT01008835001GSVIVT01008834001GSVIVT01024031001
Zea maysAC234152.1_FGT005
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)