Basic Information | |
---|---|
Species | Eucalyptus grandis |
Cazyme ID | Eucgr.J02679.1 |
Family | GH35 |
Protein Properties | Length: 110 Molecular Weight: 12137.9 Isoelectric Point: 5.6026 |
Chromosome | Chromosome/Scaffold: 10 Start: 33232284 End: 33235389 |
Description | beta-galactosidase 17 |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH35 | 2 | 93 | 2.6e-26 |
LRSSNPAFVKLVERWWGILLPKVSSLLYDNGGPIIMVQIENEFSSYGDNKTYIRHLAKLAQGYLGDEVILYTTDGGSKETLQKGTVGGEDVF |
Full Sequence |
---|
Protein Sequence Length: 110 Download |
MLRSSNPAFV KLVERWWGIL LPKVSSLLYD NGGPIIMVQI ENEFSSYGDN KTYIRHLAKL 60 AQGYLGDEVI LYTTDGGSKE TLQKGTVGGE DVFSGEFIVH VCFVDLGRH* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
COG1874 | LacA | 0.002 | 5 | 56 | 52 | + Beta-galactosidase [Carbohydrate transport and metabolism] |
pfam01301 | Glyco_hydro_35 | 2.0e-31 | 2 | 93 | 92 | + Glycosyl hydrolases family 35. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACU17905.1 | 6e-37 | 3 | 95 | 182 | 274 | unknown [Glycine max] |
EMBL | CBI35958.1 | 9e-37 | 2 | 95 | 189 | 282 | unnamed protein product [Vitis vinifera] |
RefSeq | NP_001031273.1 | 3e-36 | 2 | 95 | 115 | 208 | BGAL17 (beta-galactosidase 17); beta-galactosidase/ catalytic/ cation binding [Arabidopsis thaliana] |
RefSeq | XP_002280228.1 | 9e-37 | 2 | 95 | 165 | 258 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002327549.1 | 2e-39 | 2 | 94 | 123 | 215 | predicted protein [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3thd_D | 8e-22 | 1 | 89 | 123 | 212 | B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor |
PDB | 3thd_C | 8e-22 | 1 | 89 | 123 | 212 | B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor |
PDB | 3thd_B | 8e-22 | 1 | 89 | 123 | 212 | B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor |
PDB | 3thd_A | 8e-22 | 1 | 89 | 123 | 212 | B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor |
PDB | 3thc_D | 8e-22 | 1 | 89 | 123 | 212 | A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
JG640400 | 94 | 2 | 95 | 2.99878e-43 |
JG640395 | 94 | 2 | 95 | 3.9937e-43 |
EB681802 | 94 | 2 | 95 | 3e-40 |
HO705240 | 93 | 3 | 95 | 2e-39 |
CO091306 | 94 | 2 | 95 | 2e-39 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |