y PlantCAZyme

CAZyme Information

Basic Information
SpeciesEucalyptus grandis
Cazyme IDEucgr.J02679.1
FamilyGH35
Protein PropertiesLength: 110 Molecular Weight: 12137.9 Isoelectric Point: 5.6026
ChromosomeChromosome/Scaffold: 10 Start: 33232284 End: 33235389
Descriptionbeta-galactosidase 17
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH352932.6e-26
  LRSSNPAFVKLVERWWGILLPKVSSLLYDNGGPIIMVQIENEFSSYGDNKTYIRHLAKLAQGYLGDEVILYTTDGGSKETLQKGTVGGEDVF
Full Sequence
Protein Sequence     Length: 110     Download
MLRSSNPAFV KLVERWWGIL LPKVSSLLYD NGGPIIMVQI ENEFSSYGDN KTYIRHLAKL    60
AQGYLGDEVI LYTTDGGSKE TLQKGTVGGE DVFSGEFIVH VCFVDLGRH*               120
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG1874LacA0.00255652+
pfam01301Glyco_hydro_352.0e-3129392+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU17905.16e-37395182274unknown [Glycine max]
EMBLCBI35958.19e-37295189282unnamed protein product [Vitis vinifera]
RefSeqNP_001031273.13e-36295115208BGAL17 (beta-galactosidase 17); beta-galactosidase/ catalytic/ cation binding [Arabidopsis thaliana]
RefSeqXP_002280228.19e-37295165258PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002327549.12e-39294123215predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3thd_D8e-22189123212B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3thd_C8e-22189123212B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3thd_B8e-22189123212B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3thd_A8e-22189123212B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3thc_D8e-22189123212A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG640400942952.99878e-43
JG640395942953.9937e-43
EB681802942953e-40
HO705240933952e-39
CO091306942952e-39
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_020_00429.1
Arabidopsis lyrata877397
Arabidopsis thalianaAT1G72990.2AT1G72990.1
Brachypodium distachyonBradi2g18440.2Bradi2g18440.3
Brassica rapaBra003861
Carica papayaevm.model.supercontig_1398.1evm.model.supercontig_25.44
Capsella rubellaCarubv10022320m
Citrus clementinaCiclev10024990mCiclev10024996m
Citrus sinensisorange1.1g011205morange1.1g006708morange1.1g006713morange1.1g006715morange1.1g006845m
orange1.1g007259morange1.1g009269morange1.1g011211m
Cucumis sativusCucsa.341150.1
Eucalyptus grandisEucgr.J02852.1
Fragaria vescamrna23038.1-v1.0-hybrid
Glycine maxGlyma13g42560.1Glyma13g42560.2
Gossypium raimondiiGorai.008G075700.1Gorai.008G075700.2Gorai.009G141300.1Gorai.009G141300.2Gorai.009G141300.3
Linum usitatissimumLus10015616Lus10037634
Malus domesticaMDP0000944874MDP0000921848
Manihot esculentacassava4.1_026281mcassava4.1_034020m
Medicago truncatulaMedtr2g100000.1
Mimulus guttatusmgv1a002369m
Oryza sativaLOC_Os05g46200.2LOC_Os05g46200.1LOC_Os05g46200.3
Panicum virgatumPavirv00010551mPavirv00046579m
Physcomitrella patensPp1s149_266V6.1Pp1s52_244V6.1Pp1s52_244V6.2
Phaseolus vulgarisPhvul.005G158700.1
Picea abiesMA_775331g0010MA_8535581g0010
Populus trichocarpaPotri.003G040000.1Potri.003G037000.1
Prunus persicappa002232m
Ricinus communis28694.m000663.153.29928694.m000663.153.29928694.m000663.62.15328694.m000663.62.153
Setaria italicaSi021395mSi021403m
Selaginella moellendorffii61485
Sorghum bicolorSb09g026870.1
Thellungiella halophilaThhalv10018211m
Vitis viniferaGSVIVT01016865001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny