y PlantCAZyme

CAZyme Information

Basic Information
SpeciesEucalyptus grandis
Cazyme IDEucgr.J02852.1
FamilyGH35
Protein PropertiesLength: 714 Molecular Weight: 78935.4 Isoelectric Point: 8.4665
ChromosomeChromosome/Scaffold: 10 Start: 35479921 End: 35492043
Descriptionbeta-galactosidase 17
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH35844080
  FWKDGSPFQIIGGDVHYFRVLPEYWEDRLLRAKALGLNTIQTYVPWNLHEPKPGETVFEGIADIISFLNLCKKLDLLVMLRVGPYICAEWDFGGFPYWLL
  AIKPALTLRSSDPAFVKLVEQWWSILLPKVSSLLYANGGPIIMVQIENEYGSYGDDKTYLRHLVKLARGYLGNEVILYTTDGGSKETLQKGTVGGEDVFS
  AVDFDTGAEAWPIFNLQKQFNAPGKSPPLAAEFYTGWLTHWGEKLAQTDAEFTAAALEKILSRNGSAVLYMAHGGTNFGFYNGANTGGSESEYKPDLTSY
  DYDAPIKESGDVDNPKYKAIRKVVE
Full Sequence
Protein Sequence     Length: 714     Download
MPVRTATSNA LPLHRAAPAA SRAAAMARKR GLRATTVVFF GLLSLAAFGA FVPALAPLPS    60
LSSPHPSLPR KSSSRKFEID SDKFWKDGSP FQIIGGDVHY FRVLPEYWED RLLRAKALGL    120
NTIQTYVPWN LHEPKPGETV FEGIADIISF LNLCKKLDLL VMLRVGPYIC AEWDFGGFPY    180
WLLAIKPALT LRSSDPAFVK LVEQWWSILL PKVSSLLYAN GGPIIMVQIE NEYGSYGDDK    240
TYLRHLVKLA RGYLGNEVIL YTTDGGSKET LQKGTVGGED VFSAVDFDTG AEAWPIFNLQ    300
KQFNAPGKSP PLAAEFYTGW LTHWGEKLAQ TDAEFTAAAL EKILSRNGSA VLYMAHGGTN    360
FGFYNGANTG GSESEYKPDL TSYDYDAPIK ESGDVDNPKY KAIRKVVEQY SIVPLPSVPY    420
NNAKTSYGRI QLQRTSFLFD LLNVLGPHDV VESESPLSME LVGQMFGFLL YATKFASTDD    480
GSMLTIPKVH DRGQVFVSCA SRKDRPLYAG AIERWSNKPL HLPVTKCASR INLYVLVENM    540
GRVNYGSYMF DMKGILSSVY LNGRVLLGWK MFSIPLHNLN EATTINSVVQ VRHSGIMRVL    600
SNRSINKSDG VTREPAFYAG SFHVNEVAQI KDTFISFQGW GKGVAYVNDF NIGRFWPSFG    660
PQCNLYVPAP VLRVGVNSLV VLELESPKPD LALHSVDEPD FSCGKSKSSV HHL*          720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02449Glyco_hydro_420.0004101239161+
COG1874LacA2.0e-3480403353+
PLN03059PLN030595.0e-4593404332+
pfam01301Glyco_hydro_358.0e-15684410327+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI35958.1047103707unnamed protein product [Vitis vinifera]
RefSeqNP_001031273.109871322635BGAL17 (beta-galactosidase 17); beta-galactosidase/ catalytic/ cation binding [Arabidopsis thaliana]
RefSeqNP_565051.107071356697BGAL17 (beta-galactosidase 17); beta-galactosidase/ catalytic/ cation binding [Arabidopsis thaliana]
RefSeqXP_002280228.10267101683PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002327549.10757131643predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3thd_D0706992619A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose
PDB3thd_C0706992619A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose
PDB3thd_B0706992619A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose
PDB3thd_A0706992619A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose
PDB3thc_D0706992619A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose
Transmembrane Domains
StartEnd
3658
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO0913062871574430
DY905780281773570
DY939729278773540
EL450710269773450
DY905891263773390
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_020_00429.1
Arabidopsis lyrata877397
Arabidopsis thalianaAT1G72990.2AT1G72990.1
Brachypodium distachyonBradi2g18440.2Bradi2g18440.3
Brassica rapaBra003861
Carica papayaevm.model.supercontig_1398.1evm.model.supercontig_25.44
Capsella rubellaCarubv10022320m
Citrus clementinaCiclev10024990mCiclev10024996m
Citrus sinensisorange1.1g011205morange1.1g006708morange1.1g006713morange1.1g006715morange1.1g006845m
orange1.1g007259morange1.1g009269morange1.1g011211m
Cucumis sativusCucsa.341150.1
Eucalyptus grandisEucgr.J02679.1
Fragaria vescamrna23038.1-v1.0-hybrid
Glycine maxGlyma13g42560.1Glyma13g42560.2
Gossypium raimondiiGorai.008G075700.1Gorai.008G075700.2Gorai.009G141300.1Gorai.009G141300.2Gorai.009G141300.3
Linum usitatissimumLus10015616Lus10037634
Malus domesticaMDP0000944874MDP0000921848
Manihot esculentacassava4.1_026281mcassava4.1_034020m
Medicago truncatulaMedtr2g100000.1
Mimulus guttatusmgv1a002369m
Oryza sativaLOC_Os05g46200.2LOC_Os05g46200.1LOC_Os05g46200.3
Panicum virgatumPavirv00010551mPavirv00046579m
Physcomitrella patensPp1s149_266V6.1Pp1s52_244V6.1Pp1s52_244V6.2
Phaseolus vulgarisPhvul.005G158700.1
Picea abiesMA_775331g0010MA_8535581g0010
Populus trichocarpaPotri.003G040000.1Potri.003G037000.1
Prunus persicappa002232m
Ricinus communis28694.m000663.153.29928694.m000663.153.29928694.m000663.62.15328694.m000663.62.153
Setaria italicaSi021395mSi021403m
Selaginella moellendorffii61485
Sorghum bicolorSb09g026870.1
Thellungiella halophilaThhalv10018211m
Vitis viniferaGSVIVT01016865001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny