y PlantCAZyme

CAZyme Information

Basic Information
SpeciesEucalyptus grandis
Cazyme IDEucgr.L00641.1
FamilyGT41
Protein PropertiesLength: 951 Molecular Weight: 107421 Isoelectric Point: 7.2396
ChromosomeChromosome/Scaffold: 41 Start: 100857 End: 109136
DescriptionTetratricopeptide repeat (TPR)-like superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT415507180
  FPAQYPVKSDGGSGRLRVGYVSSDFGNHPLSHLMGSVFGMHGRENIEVFCYALSANDGTEWRLRTQSEAEHFIDVSSMTSDMIARLINDHKIQILVNLNG
  YTKGARNEIFAMQPAPIQISYMGFPGTTGASYINYLVTDEFVSPFHLSHIYSEKLVHLPHCYFVNDYKQ
GT417309290
  PKRSDYGLPEDKFIFACFNQLYKMDPDIVNTWCNILKRVPNSALWLLRFPAAGETRLRNYATQRGVQPDQIIFTDVAMKNEHIKRSALADLFLDTPLCNA
  HTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGVGEEMIVNSLKEYEEKAVSLALNRPKLEDLKSRLKAARLTCPLFDTTRWVRNLERAYFKMWNLHC
Full Sequence
Protein Sequence     Length: 951     Download
MVLPLVAKET SDLIGHREDR LHYSNEDILI ALAHQKYKAG SYKQALEHSQ AVYERNPRRT    60
DNLLLLGAIY YQLHDLDMCI AKNEEALQID PHFAECYGNM ANAWKEKGNI DAAIRYYLIA    120
IELRPNFADA WSNLGSAYMR KGRYNEAGQC CRQALQLNPR LVDAQSNLGN LMKAQGLVQE    180
AFNCYLEAIR IQPTFAIAWS NLAGLFMEAG DLNKALQYYK EAVKLRPTFS DAYLNLGNVY    240
KALGMPQEAI ICYQRALQSR PDYAMAYGNL ASIHYEQGQL DLAILNYKRA ITFDSSFLEA    300
YNNLGNALKD SGKVEEAINC YRHCLSLQPN HPQALTNLGN IYMEWNMLSV AASFYKATLT    360
VTMGLSAPFN NLAIIYKQQG NYADAITCYN EVLRIDPMAA DGLVNRGNTY KEIGRVSEAI    420
QDYIRAINIR PTMAEAHANL ASAYKDSGHV EPAIKSYKQA LALRPDFPEA TCNLLHTLQC    480
VCDWEDREKK FSEVEGILRR QIKMSVIPSV QPFHAIAYPI DPMLALEISR KYAAYSALVA    540
SRYSLPSFNF PAQYPVKSDG GSGRLRVGYV SSDFGNHPLS HLMGSVFGMH GRENIEVFCY    600
ALSANDGTEW RLRTQSEAEH FIDVSSMTSD MIARLINDHK IQILVNLNGY TKGARNEIFA    660
MQPAPIQISY MGFPGTTGAS YINYLVTDEF VSPFHLSHIY SEKLVHLPHC YFVNDYKQKN    720
REVLDSSCHP KRSDYGLPED KFIFACFNQL YKMDPDIVNT WCNILKRVPN SALWLLRFPA    780
AGETRLRNYA TQRGVQPDQI IFTDVAMKNE HIKRSALADL FLDTPLCNAH TTGTDVLWAG    840
LPMVTLPLEK MATRVAGSLC LATGVGEEMI VNSLKEYEEK AVSLALNRPK LEDLKSRLKA    900
ARLTCPLFDT TRWVRNLERA YFKMWNLHCS GQHPQPFKVT ENDSEFPYNR *             960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam13844Glyco_transf_416.0e-68565734176+
pfam13844Glyco_transf_411.0e-76732925194+
COG3914Spy9.0e-98370926568+
Gene Ontology
GO TermDescription
GO:0005515protein binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_187074.101995046977SEC (secret agent); transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002270163.102295058986PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002319130.10259471923predicted protein [Populus trichocarpa]
RefSeqXP_002453843.1025950861011hypothetical protein SORBIDRAFT_04g019560 [Sorghum bicolor]
RefSeqXP_002522031.101995048979o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4gz6_D03297256404A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB4gz6_D0713934495715A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB4gz6_D7e-301593096156A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB4gz6_D9e-29912386153A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB4gz6_D3e-261252716152A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7952474634899510
HO7787254505029510
HO798232408264330
HO798232367994650
HO795247514394892e-18
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_058_00216.4.161.321Aquca_058_00216.4.161.321Aquca_058_00216.3.387.547Aquca_058_00216.3.387.547Aquca_058_00216.2
Aquca_058_00216.1.601.761Aquca_058_00216.1.601.761Aquca_072_00077.2Aquca_072_00077.3Aquca_072_00077.1
Arabidopsis lyrata896453.457.745896453.457.745478494
Arabidopsis thalianaAT3G04240.1.457.745AT3G04240.1.457.745AT3G11540.1AT3G11540.2
Brachypodium distachyonBradi3g43577.3.610.769Bradi3g43577.3.610.769Bradi3g43577.2Bradi3g43577.1Bradi5g06647.1.621.781
Bradi5g06647.1.621.781Bradi2g58616.1.592.750Bradi2g58616.1.592.750Bradi3g42910.1
Brassica rapaBra040144.586.743Bra040144.586.743Bra001408Bra034832
Carica papayaevm.model.supercontig_51.46.234.522evm.model.supercontig_51.46.234.522
Capsella rubellaCarubv10012900m.457.745Carubv10012900m.457.745Carubv10013012mCarubv10012928m
Chlamydomonas reinhardtiig13482.t1
Citrus clementinaCiclev10018711m.453.741Ciclev10018711m.453.741Ciclev10011210mCiclev10011021m
Citrus sinensisorange1.1g003557m.291.579orange1.1g003557m.291.579orange1.1g002729m.402.690orange1.1g002729m.402.690orange1.1g002431m.402.690
orange1.1g002431m.402.690orange1.1g005626morange1.1g005594morange1.1g004753morange1.1g007075m
orange1.1g002273morange1.1g003891morange1.1g002443morange1.1g002441morange1.1g002438m
orange1.1g006937morange1.1g007634m
Cucumis sativusCucsa.027630.1.563.753Cucsa.027630.1.563.753Cucsa.083560.1
Eucalyptus grandisEucgr.L00641.1.550.718Eucgr.L00641.1.550.718Eucgr.K02568.1
Fragaria vescamrna16720.1-v1.0-hybrid.551.739mrna16720.1-v1.0-hybrid.551.739mrna15637.1-v1.0-hybrid
Glycine maxGlyma10g31190.2Glyma10g31190.1.468.756Glyma10g31190.1.468.756Glyma20g36330.1.468.756Glyma20g36330.1.468.756
Glyma20g36330.2Glyma19g38241.2Glyma19g38241.1Glyma03g35610.3Glyma03g35610.2
Glyma02g36210.4Glyma02g36210.3Glyma10g08710.1
Gossypium raimondiiGorai.011G150500.2.480.766Gorai.011G150500.2.480.766Gorai.011G150500.1.481.772Gorai.011G150500.1.481.772Gorai.011G150500.3
Gorai.013G189100.3.376.564Gorai.013G189100.3.376.564Gorai.013G189100.2.571.758Gorai.013G189100.2.571.758Gorai.013G189100.1.571.758
Gorai.013G189100.1.571.758Gorai.011G150500.5.520.693Gorai.011G150500.5.520.693Gorai.011G150500.4.520.693Gorai.011G150500.4.520.693
Gorai.007G367900.2Gorai.007G367900.1Gorai.002G238200.2Gorai.002G238200.1
Linum usitatissimumLus10003576.450.737Lus10003576.450.737Lus10004779.456.744Lus10004779.456.744Lus10003113.456.744
Lus10003113.456.744Lus10021336Lus10017009
Malus domesticaMDP0000233292.459.747MDP0000233292.459.747MDP0000119499MDP0000212192MDP0000846748
Manihot esculentacassava4.1_001015m.583.740cassava4.1_001015m.583.740cassava4.1_002695m.313.473cassava4.1_002695m.313.473cassava4.1_002691m.313.473
cassava4.1_002691m.313.473cassava4.1_001021m.581.740cassava4.1_001021m.581.740cassava4.1_001222mcassava4.1_001239m
cassava4.1_001390m
Medicago truncatulaMedtr1g079510.2.224.512Medtr1g079510.2.224.512Medtr1g079510.1.466.754Medtr1g079510.1.466.754
Mimulus guttatusmgv1a000777m.468.756mgv1a000777m.468.756mgv1a000982m.534.691mgv1a000982m.534.691mgv1a000971m
Oryza sativaLOC_Os01g68680.1.495.747LOC_Os01g68680.1.495.747LOC_Os02g28830.1.255.415LOC_Os02g28830.1.255.415LOC_Os08g44510.1
Panicum virgatumPavirv00063187m.616.777Pavirv00063187m.616.777Pavirv00007611mPavirv00052192m
Physcomitrella patensPp1s263_4V6.1.478.766Pp1s263_4V6.1.478.766Pp1s177_132V6.1.476.764Pp1s177_132V6.1.476.764Pp1s346_18V6.1
Pp1s456_4V6.1Pp1s150_16V6.1
Phaseolus vulgarisPhvul.007G119800.1.469.757Phvul.007G119800.1.469.757Phvul.001G192300.2Phvul.001G192300.1Phvul.007G153100.2
Phvul.007G153100.1
Picea abiesMA_76964g0020.246.533MA_76964g0020.246.533MA_247226g0010.309.469MA_247226g0010.309.469MA_869746g0010
MA_475186g0010MA_261690g0010
Populus trichocarpaPotri.013G051400.7.84.372Potri.013G051400.7.84.372Potri.013G051400.6.224.512Potri.013G051400.6.224.512Potri.013G051400.5
Potri.013G051400.4.463.751Potri.013G051400.4.463.751Potri.013G051400.3.463.751Potri.013G051400.3.463.751Potri.013G051400.2.463.751
Potri.013G051400.2.463.751Potri.013G051400.1.463.751Potri.013G051400.1.463.751Potri.019G025600.5.224.512Potri.019G025600.5.224.512
Potri.019G025600.2.459.747Potri.019G025600.2.459.747Potri.019G025600.1.459.747Potri.019G025600.1.459.747Potri.019G025600.6.213.376
Potri.019G025600.6.213.376Potri.019G025600.4.417.580Potri.019G025600.4.417.580Potri.019G025600.3.478.641Potri.019G025600.3.478.641
Potri.006G208900.1Potri.016G075700.4Potri.016G075700.3Potri.016G075700.1Potri.016G075700.2
Potri.006G208900.3Potri.006G208900.2
Prunus persicappa000862m.459.747ppa000862m.459.747ppa001075m
Ricinus communis29680.m001749.589.74729680.m001749.589.74727556.m00005030032.m00047548742.m000013
Setaria italicaSi016363mSi016197m.619.779Si016197m.619.779Si000265m.480.641Si000265m.480.641
Si013329mSi013225m
Selaginella moellendorffii143846.391.643143846.391.643159012
Sorghum bicolorSb04g019560.1.619.779Sb04g019560.1.619.779Sb07g024110.1
Thellungiella halophilaThhalv10020104mThhalv10020000m.431.719Thhalv10020000m.431.719Thhalv10019996m.457.745Thhalv10019996m.457.745
Thhalv10020052mThhalv10020017m
Vitis viniferaGSVIVT01026359001.593.754GSVIVT01026359001.593.754GSVIVT01033891001
Volvox carteriVocar20006483m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)