| Basic Information | |
|---|---|
| Species | Eucalyptus grandis |
| Cazyme ID | Eucgr.L02927.1 |
| Family | GH35 |
| Protein Properties | Length: 150 Molecular Weight: 16536.9 Isoelectric Point: 8.428 |
| Chromosome | Chromosome/Scaffold: 1639 Start: 5844 End: 7358 |
| Description | beta galactosidase 9 |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH35 | 50 | 142 | 3.89561e-43 |
| LIIDGKRRMLNSAGIHYPRATPEMWPDLIAKSKEGGADVVQTYAFWSGHEPVRGQYYFEGSYDIVKFVKLVGSSGMYLHLRIGPYVCAEWNFG | |||
| Full Sequence |
|---|
| Protein Sequence Length: 150 Download |
| MAERRRNSLP FLLLLAIVHF AAAAAAAASA SAGSASFFEP FNVSYDHRAL IIDGKRRMLN 60 SAGIHYPRAT PEMWPDLIAK SKEGGADVVQ TYAFWSGHEP VRGQYYFEGS YDIVKFVKLV 120 GSSGMYLHLR IGPYVCAEWN FGSHLLSDY* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam02449 | Glyco_hydro_42 | 0.006 | 65 | 130 | 67 | + Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues. | ||
| COG1874 | LacA | 7.0e-14 | 43 | 144 | 104 | + Beta-galactosidase [Carbohydrate transport and metabolism] | ||
| pfam01301 | Glyco_hydro_35 | 1.0e-49 | 49 | 142 | 94 | + Glycosyl hydrolases family 35. | ||
| PLN03059 | PLN03059 | 2.0e-55 | 42 | 142 | 101 | + beta-galactosidase; Provisional | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| DDBJ | BAD91079.1 | 0 | 12 | 142 | 14 | 135 | beta-D-galactosidase [Pyrus pyrifolia] |
| DDBJ | BAE72075.1 | 0 | 12 | 142 | 14 | 135 | pear beta-galactosidase3 [Pyrus communis] |
| EMBL | CBI17270.1 | 0 | 38 | 142 | 24 | 128 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002263385.1 | 0 | 38 | 142 | 24 | 128 | PREDICTED: similar to pear beta-galactosidase3 [Vitis vinifera] |
| RefSeq | XP_002328900.1 | 0 | 34 | 142 | 27 | 135 | predicted protein [Populus trichocarpa] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3d3a_A | 4e-20 | 50 | 142 | 15 | 107 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 4e8d_B | 1e-18 | 52 | 142 | 12 | 102 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 4e8d_A | 1e-18 | 52 | 142 | 12 | 102 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 4e8c_B | 1e-18 | 52 | 142 | 12 | 102 | A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose |
| PDB | 4e8c_A | 1e-18 | 52 | 142 | 12 | 102 | A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose |
| Transmembrane Domains | ||||
|---|---|---|---|---|
 | ||||
| Start | End | |||
| 7 | 29 | |||
| Signal Peptide | ||||
|---|---|---|---|---|
 | ||||
| Cleavage Site | ||||
| 23 | ||||
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| ES594305 | 142 | 1 | 142 | 0 |
| BU575110 | 111 | 37 | 147 | 0 |
| FG442740 | 106 | 37 | 142 | 0 |
| EB152243 | 106 | 37 | 142 | 0 |
| EB151240 | 106 | 37 | 142 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |