y PlantCAZyme

CAZyme Information

Basic Information
SpeciesEucalyptus grandis
Cazyme IDEucgr.L02927.1
FamilyGH35
Protein PropertiesLength: 150 Molecular Weight: 16536.9 Isoelectric Point: 8.428
ChromosomeChromosome/Scaffold: 1639 Start: 5844 End: 7358
Descriptionbeta galactosidase 9
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH35501423.89561e-43
  LIIDGKRRMLNSAGIHYPRATPEMWPDLIAKSKEGGADVVQTYAFWSGHEPVRGQYYFEGSYDIVKFVKLVGSSGMYLHLRIGPYVCAEWNFG
Full Sequence
Protein Sequence     Length: 150     Download
MAERRRNSLP FLLLLAIVHF AAAAAAAASA SAGSASFFEP FNVSYDHRAL IIDGKRRMLN    60
SAGIHYPRAT PEMWPDLIAK SKEGGADVVQ TYAFWSGHEP VRGQYYFEGS YDIVKFVKLV    120
GSSGMYLHLR IGPYVCAEWN FGSHLLSDY*                                     180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02449Glyco_hydro_420.0066513067+
COG1874LacA7.0e-1443144104+
pfam01301Glyco_hydro_351.0e-494914294+
PLN03059PLN030592.0e-5542142101+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAD91079.101214214135beta-D-galactosidase [Pyrus pyrifolia]
DDBJBAE72075.101214214135pear beta-galactosidase3 [Pyrus communis]
EMBLCBI17270.103814224128unnamed protein product [Vitis vinifera]
RefSeqXP_002263385.103814224128PREDICTED: similar to pear beta-galactosidase3 [Vitis vinifera]
RefSeqXP_002328900.103414227135predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d3a_A4e-205014215107A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB4e8d_B1e-185214212102A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB4e8d_A1e-185214212102A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB4e8c_B1e-185214212102A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose
PDB4e8c_A1e-185214212102A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
23
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES59430514211420
BU575110111371470
FG442740106371420
EB152243106371420
EB151240106371420
Orthologous Group
SpeciesID
Brassica rapaBra003545Bra013956.10.92Bra013956.10.92
Linum usitatissimumLus10008974.39.133Lus10008974.39.133Lus10008974.39.133
Picea abiesMA_168609g0010MA_665188g0010
Setaria italicaSi006174m.37.128Si006174m.37.128Si005914m.37.128Si005914m.37.128
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny