y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G001497_T01
FamilyGT77
Protein PropertiesLength: 351 Molecular Weight: 39608.3 Isoelectric Point: 8.2195
ChromosomeChromosome/Scaffold: 3 Start: 160303613 End: 160305506
Description
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT771002970
  LNNVLVVAVDAKAFSHCRAVHPHCYLLEVKTIDLSSANNYMSEAYIELVWTKLSLLQRILELGYNFLFTDVDIVWFRNPFRHISVFADMTTSSDVFYGDA
  DGLDNWPNTGFFYVKATSRTVEMLRRWRAARARFPANHEQAIFNDIKHELARDLGARVQFLDTARFGSFCRIFHIDMAAACTMHANCCVGLGNKLHDL
Full Sequence
Protein Sequence     Length: 351     Download
MWLATVFALL ILFALASIGR SSRMLEKSYY TETEVASRGD SVTSQDPAEM SDLARLLPKV    60
ATDDRTVIIT SVNEAFARPD SLLGLFRESF QAGEGIGHLL NNVLVVAVDA KAFSHCRAVH    120
PHCYLLEVKT IDLSSANNYM SEAYIELVWT KLSLLQRILE LGYNFLFTDV DIVWFRNPFR    180
HISVFADMTT SSDVFYGDAD GLDNWPNTGF FYVKATSRTV EMLRRWRAAR ARFPANHEQA    240
IFNDIKHELA RDLGARVQFL DTARFGSFCR IFHIDMAAAC TMHANCCVGL GNKLHDLRDV    300
LRQWKNYTGL TPQAKKSQKF IWKDPAKCGT PDKRKRTHES EKCTTSASIV *             360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans2.0e-63107297201+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAY77007.101433442368hypothetical protein OsI_04964 [Oryza sativa Indica Group]
GenBankEEC72056.105332886360hypothetical protein OsI_04966 [Oryza sativa Indica Group]
RefSeqNP_001045222.101433442368Os01g0920700 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001045223.105332886360Os01g0921000 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002456849.104933413298hypothetical protein SORBIDRAFT_03g044030 [Sorghum bicolor]
Transmembrane Domains
StartEnd
219
Signal Peptide
Cleavage Site
21
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FL7190031851503340
FL719002177482230
CT845264279513280
CO444543273473170
FL054516263473070