| Basic Information | |
|---|---|
| Species | Zea mays |
| Cazyme ID | GRMZM2G004211_T02 |
| Family | AA2 |
| Protein Properties | Length: 146 Molecular Weight: 15981.5 Isoelectric Point: 9.0277 |
| Chromosome | Chromosome/Scaffold: 10 Start: 101005277 End: 101007288 |
| Description | ascorbate peroxidase 3 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| AA2 | 23 | 97 | 1.3e-23 |
| ALVASKNCAPIMLRLAWHDAGTYDAKTNTGGPNGSIRFPQEYSHSSNAGIKIAIDLLEPVKQKHPKITYADLYQV | |||
| Full Sequence |
|---|
| Protein Sequence Length: 146 Download |
| MSAPLVDAEY MAEIERARRD LRALVASKNC APIMLRLAWH DAGTYDAKTN TGGPNGSIRF 60 PQEYSHSSNA GIKIAIDLLE PVKQKHPKIT YADLYQVVVV QLFTQSIRTV PWFIVVRFID 120 QLAGVVAVEV TGGPTVDFVP GRKVS* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00141 | peroxidase | 4.0e-24 | 17 | 143 | 135 | + Peroxidase. | ||
| PLN02364 | PLN02364 | 1.0e-41 | 4 | 143 | 140 | + L-ascorbate peroxidase 1 | ||
| PLN02879 | PLN02879 | 1.0e-43 | 2 | 142 | 141 | + L-ascorbate peroxidase | ||
| cd00691 | ascorbate_peroxidase | 1.0e-63 | 3 | 143 | 142 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. | ||
| PLN02608 | PLN02608 | 1.0e-83 | 1 | 145 | 145 | + L-ascorbate peroxidase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004601 | peroxidase activity |
| GO:0006979 | response to oxidative stress |
| GO:0020037 | heme binding |
| GO:0055114 | oxidation-reduction process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACN36535.1 | 0 | 1 | 145 | 1 | 145 | unknown [Zea mays] |
| GenBank | ACR37850.1 | 0 | 1 | 145 | 1 | 120 | unknown [Zea mays] |
| RefSeq | NP_001052271.1 | 0 | 2 | 145 | 3 | 121 | Os04g0223300 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | NP_001148710.1 | 0 | 1 | 145 | 1 | 120 | APx3 - Peroxisomal Ascorbate Peroxidase [Zea mays] |
| RefSeq | XP_002446119.1 | 0 | 1 | 145 | 1 | 120 | hypothetical protein SORBIDRAFT_06g001970 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2xj6_A | 8e-40 | 2 | 143 | 3 | 119 | A Chain A, The Structure Of Ascorbate Peroxidase Compound Ii |
| PDB | 2xih_A | 8e-40 | 2 | 143 | 3 | 119 | A Chain A, The Structure Of Ascorbate Peroxidase Compound Ii |
| PDB | 2xif_A | 8e-40 | 2 | 143 | 3 | 119 | A Chain A, The Structure Of Ascorbate Peroxidase Compound Ii |
| PDB | 2xi6_A | 8e-40 | 2 | 143 | 3 | 119 | A Chain A, The Structure Of Ascorbate Peroxidase Compound Ii |
| PDB | 2vcf_X | 1e-39 | 2 | 143 | 15 | 131 | X Chain X, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean Ascorbate Peroxidase |
| Hydropathy |
|---|
 |
