| Basic Information | |
|---|---|
| Species | Zea mays |
| Cazyme ID | GRMZM2G005633_T01 |
| Family | GH19 |
| Protein Properties | Length: 172 Molecular Weight: 17001.2 Isoelectric Point: 8.4936 |
| Chromosome | Chromosome/Scaffold: 10 Start: 127370239 End: 127371829 |
| Description | homolog of carrot EP3-3 chitinase |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH19 | 81 | 148 | 1.6e-22 |
| VASVVTGSFFNGIKSQAGSGCEGKNFYTRSAFLSAVKAYPGFAHGGSQVQGKREIAAFFAHATHETGR | |||
| Full Sequence |
|---|
| Protein Sequence Length: 172 Download |
| MAMAKAGAPR VSAAQLVTLG LSLLCAVAGP AAAQNCGCQP NVCCSKFGYC GTTDEYCGDG 60 CQSGPCRSGG GGSSGGGGAN VASVVTGSFF NGIKSQAGSG CEGKNFYTRS AFLSAVKAYP 120 GFAHGGSQVQ GKREIAAFFA HATHETGRKL ALSINLALQR GAGSLIFDPS C* 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00187 | Chitin_bind_1 | 1.0e-7 | 33 | 63 | 31 | + Chitin recognition protein. | ||
| cd00035 | ChtBD1 | 1.0e-7 | 38 | 64 | 27 | + Hevein or type 1 chitin binding domain. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements. | ||
| smart00270 | ChtBD1 | 7.0e-8 | 38 | 64 | 27 | + Chitin binding domain. | ||
| cd00325 | chitinase_glyco_hydro_19 | 3.0e-24 | 85 | 147 | 64 | + Glycoside hydrolase family 19 chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases but they are smaller in size due to certain deletions. Despite any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the procaryotic/eucaryotic divergence. | ||
| pfam00182 | Glyco_hydro_19 | 2.0e-24 | 84 | 147 | 65 | + Chitinase class I. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004568 | chitinase activity |
| GO:0006032 | chitin catabolic process |
| GO:0008061 | chitin binding |
| GO:0016998 | cell wall macromolecule catabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAT40005.1 | 0 | 3 | 153 | 1 | 150 | chitinase [Zea diploperennis] |
| GenBank | ACJ61981.1 | 0 | 3 | 153 | 1 | 151 | chitinase [Zea mays subsp. parviglumis] |
| GenBank | ACJ61989.1 | 0 | 3 | 153 | 1 | 151 | chitinase [Zea mays subsp. parviglumis] |
| GenBank | ACN27767.1 | 0 | 1 | 153 | 1 | 153 | unknown [Zea mays] |
| RefSeq | NP_001136749.1 | 0 | 1 | 171 | 1 | 171 | hypothetical protein LOC100216890 [Zea mays] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3hbh_A | 0.000000000000003 | 81 | 147 | 2 | 68 | A Chain A, Crystal Structure Of Brassica Juncea Chitinase Catalytic Module (Bjchi3) |
| PDB | 3hbe_X | 0.000000000000003 | 81 | 147 | 2 | 68 | A Chain A, Crystal Structure Of Brassica Juncea Chitinase Catalytic Module (Bjchi3) |
| PDB | 3hbd_A | 0.000000000000003 | 81 | 147 | 2 | 68 | A Chain A, Class Iv Chitinase Structure From Picea Abies At 1.8a |
| PDB | 3iwr_B | 0.0000000005 | 26 | 146 | 6 | 124 | A Chain A, Class Iv Chitinase Structure From Picea Abies At 1.8a |
| PDB | 3iwr_A | 0.0000000005 | 26 | 146 | 6 | 124 | A Chain A, Class Iv Chitinase Structure From Picea Abies At 1.8a |
