y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G006130_T01
FamilyGH51
Protein PropertiesLength: 657 Molecular Weight: 72200.2 Isoelectric Point: 4.8982
ChromosomeChromosome/Scaffold: 3 Start: 230006629 End: 230017669
Descriptionalpha-L-arabinofuranosidase 1
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH511756460
  LQNLASATITVSGTSNWTKVEQKLVAKGTNRTSRLQITTNKKGVVWLDQVSLMPEDTYKGHGFRTELISMLLDLKPRFLRFPGGCFVEGDWLRNAFRWRE
  SIGPWEERPGHFGDVWHYWTDDGLGYYEFLQLAEDLGAAPIWVFNNGISHNDEVDTVAIAPFVKDVLDSLEFARGSADSTWGSVRAAMGHPEPFLVKHVA
  IGNEDCGKKFYRGNYLKFYNAIREAYPDIQMISNCDGSSRPLDHPADLYDFHVYTDSKTLFNMRSTFDRTSRSGPKAFVSEYAVWRSDAGRGSLLASLAE
  AAFLTGLEKNSDIVQMASYAPLFVNDNDQTWNPDAIVFNSWQHYGTPSYWMQTIFRESSGAMIHPVNISSRYSSSLAASAITWQDAENSFLRVKVVNFGS
  DTVNLTVSTSGLGASVNALGSTATVLTSGNVMDENSFSNPNKVAPVKSQLSNAAEQMQVTLAPHSFTAFDLA
Full Sequence
Protein Sequence     Length: 657     Download
MDLKQAFSGT IFCLLLLFCV GCRCRTLEIE ATQTAALKVD ASPQLARKIP ETLFGIFFEE    60
INHAGAGGIW AELVSNRGFE AGGSHTPSNI DPWSIIGDDS SVFVATDRTS CFSRNIVALR    120
MEVLCDDCPA GGVGVYNPGF WGMNIEDGKA YNLVMYVQSP ETKDLTVSLT SSDGLQNLAS    180
ATITVSGTSN WTKVEQKLVA KGTNRTSRLQ ITTNKKGVVW LDQVSLMPED TYKGHGFRTE    240
LISMLLDLKP RFLRFPGGCF VEGDWLRNAF RWRESIGPWE ERPGHFGDVW HYWTDDGLGY    300
YEFLQLAEDL GAAPIWVFNN GISHNDEVDT VAIAPFVKDV LDSLEFARGS ADSTWGSVRA    360
AMGHPEPFLV KHVAIGNEDC GKKFYRGNYL KFYNAIREAY PDIQMISNCD GSSRPLDHPA    420
DLYDFHVYTD SKTLFNMRST FDRTSRSGPK AFVSEYAVWR SDAGRGSLLA SLAEAAFLTG    480
LEKNSDIVQM ASYAPLFVND NDQTWNPDAI VFNSWQHYGT PSYWMQTIFR ESSGAMIHPV    540
NISSRYSSSL AASAITWQDA ENSFLRVKVV NFGSDTVNLT VSTSGLGASV NALGSTATVL    600
TSGNVMDENS FSNPNKVAPV KSQLSNAAEQ MQVTLAPHSF TAFDLALAEP KLVAEI*       660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam06964Alpha-L-AF_C4.0e-32454639203+
COG3534AbfA3.0e-32236639480+
smart00813Alpha-L-AF_C2.0e-46454639198+
Gene Ontology
GO TermDescription
GO:0046373L-arabinose metabolic process
GO:0046556alpha-N-arabinofuranosidase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN27961.1016561656unknown [Zea mays]
GenBankACN33779.101465638680unknown [Zea mays]
GenBankEEC67598.1016561658hypothetical protein OsI_34967 [Oryza sativa Indica Group]
RefSeqNP_001148977.101465638680alpha-N-arabinofuranosidase A [Zea mays]
RefSeqXP_002442705.1016561656hypothetical protein SORBIDRAFT_08g001540 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3s2c_L9e-2323664748483A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_K9e-2323664748483A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_J9e-2323664748483A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_I9e-2323664748483A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_H9e-2323664748483A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
Signal Peptide
Cleavage Site
24
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO801860329894170
GT0462043482215680
GT0486153482816270
GT036166334233560
HO8526834262366570