y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G008263_T01
FamilyGT5
Protein PropertiesLength: 610 Molecular Weight: 66810.7 Isoelectric Point: 6.4559
ChromosomeChromosome/Scaffold: 7 Start: 34872714 End: 34879973
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT5835800
  IVFVATEVHPWCKTGGLGDVVGGLPPALAAMGHRVMTIAPRYDQYKDAWDTSVLVEVNIGDTVETVRFFHCYKRGVDRVFVDHPMFLEKVWGKTGAKLYG
  PTTGTDYRDNQLRFCLLCLAALEAPRVLNFNNSEYFSGPYGEDVVFVANDWHTAILPCYLKSMYKPNGIYKNAKVAFCIHNIAYQGRFARADFDLLNLPD
  SFLPSFDFIDGHVKPVLGRKLNWMKAGIIESDLVLTVSPHYVKELTSGPDKGVELDGVLRTKPLEIGIVNGMDVYEWDPSTDKYISVKYDATTVTEARAL
  NKESLQAEVGLPVDSSIPVIVFVGRLEEQKGSDILIAAIPEFVGENVQIIVLGTGKKKMEEELTQLEVKYPNNARGIAKFNVPLAHMMFAGADFIIVPSR
  FEPCGLIQLQGMRYGVIPICSSTGGLVDTVEEGVTGFHMGSFNVECETVDPADVTAVASTVTRALKQYDTPAFHEMVQNCMAKDLSWKGPAKKWEEVL
Full Sequence
Protein Sequence     Length: 610     Download
MAATMGSISA NGSYQTNRPS ALKQAPHMQF QQCCNGGLRF LSKHSQSTRS KIQVAKRRAT    60
DNGIHPKTTG HRAPIVCSAG MTIVFVATEV HPWCKTGGLG DVVGGLPPAL AAMGHRVMTI    120
APRYDQYKDA WDTSVLVEVN IGDTVETVRF FHCYKRGVDR VFVDHPMFLE KVWGKTGAKL    180
YGPTTGTDYR DNQLRFCLLC LAALEAPRVL NFNNSEYFSG PYGEDVVFVA NDWHTAILPC    240
YLKSMYKPNG IYKNAKVAFC IHNIAYQGRF ARADFDLLNL PDSFLPSFDF IDGHVKPVLG    300
RKLNWMKAGI IESDLVLTVS PHYVKELTSG PDKGVELDGV LRTKPLEIGI VNGMDVYEWD    360
PSTDKYISVK YDATTVTEAR ALNKESLQAE VGLPVDSSIP VIVFVGRLEE QKGSDILIAA    420
IPEFVGENVQ IIVLGTGKKK MEEELTQLEV KYPNNARGIA KFNVPLAHMM FAGADFIIVP    480
SRFEPCGLIQ LQGMRYGVIP ICSSTGGLVD TVEEGVTGFH MGSFNVECET VDPADVTAVA    540
STVTRALKQY DTPAFHEMVQ NCMAKDLSWK GPAKKWEEVL LGLGVEGSRA GIDDAEEIAP    600
LAKENVATP*                                                           660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK14099PRK140991.0e-8181578512+
COG0297GlgA4.0e-11081578516+
PRK00654glgA4.0e-13681579510+
cd03791GT1_Glycogen_synthase_DULL1_like2.0e-17183580510+
TIGR02095glgA081583508+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACG43100.1016091609granule-bound starch synthase 1b [Zea mays]
GenBankACL54413.1016091609unknown [Zea mays]
GenBankACY56072.1016091608granule-bound starch synthase II [Oryza sativa Japonica Group]
RefSeqNP_001106039.1016091609granule bound starch synthase IIa precursor [Zea mays]
RefSeqXP_002461889.1016091607hypothetical protein SORBIDRAFT_02g009870 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3vuf_A08160910536A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB3vue_A08160910536A Chain A, Crystal Structure Of Rice Granule Bound Starch Synthase I Catalytic Domain
PDB3d1j_A0815791472A Chain A, Crystal Structure Of E.Coli Gs Mutant Dmgs(C7s;c40
PDB3guh_A0815861479A Chain A, Crystal Structure Of E.Coli Gs Mutant Dmgs(C7s;c40
PDB2r4u_A0815861479A Chain A, Crystal Structure Of E.Coli Gs Mutant Dmgs(C7s;c40
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
AJ568414586286100
HO825853520896080
HO629148551636100
CX1011313532385900
CX101131715406100.009