y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G008792_T01
FamilyAA7
Protein PropertiesLength: 529 Molecular Weight: 57432.5 Isoelectric Point: 6.6437
ChromosomeChromosome/Scaffold: 2 Start: 27546080 End: 27551006
Descriptioncytokinin oxidase/dehydrogenase 1
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA7522537.7e-26
  SEAAIAVMQPGSPADIARLLGALSSTGPGPGPKAAVAARGAGHSLHGQAQARGGIVVETRALPRLVEVVRRGDGDGGGAAYADVGGGALWVEVLEECLRA
  GLAPRSWTDYLYLTVGGTLSNGGISGQAFKHGPQISNVLQLEVVTGTGEVVTCSPTQSPELFFAVLGGLGQFGIITRARIPLQVAPPKVRWVRAFYDSFE
  TF
Full Sequence
Protein Sequence     Length: 529     Download
MEGKVLCTYA GIVALLLCSS VNFIQSPSDV FGPVALLEPT ASAARDFGGV VSEAAIAVMQ    60
PGSPADIARL LGALSSTGPG PGPKAAVAAR GAGHSLHGQA QARGGIVVET RALPRLVEVV    120
RRGDGDGGGA AYADVGGGAL WVEVLEECLR AGLAPRSWTD YLYLTVGGTL SNGGISGQAF    180
KHGPQISNVL QLEVVTGTGE VVTCSPTQSP ELFFAVLGGL GQFGIITRAR IPLQVAPPKV    240
RWVRAFYDSF ETFTKDQELL VSMPELVDYV EGFMVLNEQS LRSSSVAFPA QVNFRPDFGS    300
DDGTNKKVCY YYCIEFAVHD FQRQDSAADH VVDLVSGKLS YLRPHAYSVE VAYWDFLNRV    360
RMEEESLRRR GLWDVPHPWL NLFVPRHGVA RFMDLLMATI AQGDFEGPVL VYPLLTHRWD    420
GNMSAVVPAA PDGVMYVFSV LRSTDPARCG RACMERILEQ HRRVADEACR RLGAKQYLAR    480
QPSLAHWRDH FGASWDRFVA RKARFDPMNV LGPGQGIFPW TDSSSSPM*                540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01565FAD_binding_41.0e-855192139+
COG0277GlcD2.0e-1838517496+
pfam09265Cytokin-bind4.0e-121237518290+
PLN02441PLN0244101525543+
Gene Ontology
GO TermDescription
GO:0008762UDP-N-acetylmuramate dehydrogenase activity
GO:0009690cytokinin metabolic process
GO:0016491oxidoreductase activity
GO:0019139cytokinin dehydrogenase activity
GO:0050660flavin adenine dinucleotide binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAE05712.2015261531OSJNBb0065J09.8 [Oryza sativa (japonica cultivar-group)]
GenBankEAY82296.1015261520hypothetical protein OsI_37507 [Oryza sativa Indica Group]
RefSeqNP_001064886.102252624520Os10g0483500 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002446804.1035284530hypothetical protein SORBIDRAFT_06g022930 [Sorghum bicolor]
RefSeqXP_002467062.101852120515hypothetical protein SORBIDRAFT_01g019000 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2q4w_A04351850520A Chain A, Crystal Structure Of Galactosyltransferase Lgtc In Complex With Mn And Udp-2f-Galactose
PDB2exr_A04351850520A Chain A, X-Ray Structure Of Cytokinin OxidaseDEHYDROGENASE (CKX) FROM Arabidopsis Thaliana At5g21482
PDB3s1c_A04051836515A Chain A, X-Ray Structure Of Cytokinin OxidaseDEHYDROGENASE (CKX) FROM Arabidopsis Thaliana At5g21482
PDB3dq0_A04051836515A Chain A, X-Ray Structure Of Cytokinin OxidaseDEHYDROGENASE (CKX) FROM Arabidopsis Thaliana At5g21482
PDB3c0p_A04051836515A Chain A, X-Ray Structure Of Cytokinin OxidaseDEHYDROGENASE (CKX) FROM Arabidopsis Thaliana At5g21482
Transmembrane Domains
StartEnd
527
Signal Peptide
Cleavage Site
26
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DR8051102671824480
DR9603062601894480
DR9568412432064480
EE1912581812684480
DY2370911552944480