CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G013811_T01
FamilyGH77
Protein PropertiesLength: 589 Molecular Weight: 65296.6 Isoelectric Point: 5.2802
ChromosomeChromosome/Scaffold: 7 Start: 167230471 End: 167241954
Descriptiondisproportionating enzyme
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH77965790
  LHPTSLRGPHGIGDLGDEALAFLHWLRDAGCTLWQVLPLVPPGRTAGEDGSPYSGQDANCGNTLLLSLEELVKDGLLMSDELPDPVDTEYVEFDTVANLK
  EPLIAKAAERLLLSHGELRTQYDCFKKNPNISGWLEDAALFAAIDKSINAFSWYEWPEPLKNRHLGALEDIYEKQKDFIETFMAQQFLFQRQWQRIRKYA
  QKLGISIMGDMPIYVGYHSADVWANRKSFLLDKNGFPTFVSGVPPDAFSETGQLWNSPLYDWKAMEADCFSWWIKRIKRALDLYDEFRIDHFRGLAGFWA
  VPSDAKVALVGSWRAGPRNSFFDTLFKAVGRIDIIAEDLGVITEDVVQLRKSIGAPGMAVLQFAFGGGSDNPHLPHNHEMDQVVYTGTHDNDTVLGWWQN
  LPEEEKKIVIKYLPEAENIDITWTLITAALSSVARTSVVTMQDILGLDSSARMNTPATQKGNWRWRIPSSVGFDSLSPEAAKLK
Full Sequence
Protein Sequence     Length: 589     Download
MVLARVLPLP APSSAPHRRL LLPTQAAPAP ARVLTVRAVA CRAANAMAAV ALDPPAVAPS    60
PAEVAAVGVG EELPEGYDQM MPTVEPSRRR RAGLLLHPTS LRGPHGIGDL GDEALAFLHW    120
LRDAGCTLWQ VLPLVPPGRT AGEDGSPYSG QDANCGNTLL LSLEELVKDG LLMSDELPDP    180
VDTEYVEFDT VANLKEPLIA KAAERLLLSH GELRTQYDCF KKNPNISGWL EDAALFAAID    240
KSINAFSWYE WPEPLKNRHL GALEDIYEKQ KDFIETFMAQ QFLFQRQWQR IRKYAQKLGI    300
SIMGDMPIYV GYHSADVWAN RKSFLLDKNG FPTFVSGVPP DAFSETGQLW NSPLYDWKAM    360
EADCFSWWIK RIKRALDLYD EFRIDHFRGL AGFWAVPSDA KVALVGSWRA GPRNSFFDTL    420
FKAVGRIDII AEDLGVITED VVQLRKSIGA PGMAVLQFAF GGGSDNPHLP HNHEMDQVVY    480
TGTHDNDTVL GWWQNLPEEE KKIVIKYLPE AENIDITWTL ITAALSSVAR TSVVTMQDIL    540
GLDSSARMNT PATQKGNWRW RIPSSVGFDS LSPEAAKLKE LLALYNRQ* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR00217malQ3.0e-10882572501+
COG1640MalQ4.0e-13187573503+
pfam02446Glyco_hydro_771.0e-17596570491+
PLN02635PLN02635077587511+
PRK14508PRK14508088572488+
Gene Ontology
GO TermDescription
GO:00041344-alpha-glucanotransferase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAZ23613.1015871577disproportionating enzyme [Aegilops tauschii]
GenBankACN26217.1015881588unknown [Zea mays]
GenBankEEC82491.10565872554hypothetical protein OsI_26949 [Oryza sativa Indica Group]
GenBankEEE67630.10565872554hypothetical protein OsJ_25204 [Oryza sativa Japonica Group]
RefSeqXP_002461064.1015881590hypothetical protein SORBIDRAFT_02g040000 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1x1n_A0655871523A Chain A, Structure Determination And Refinement At 1.8 A Resolution Of Disproportionating Enzyme From Potato
PDB2owx_A0905818496A Chain A, Structure Determination And Refinement At 1.8 A Resolution Of Disproportionating Enzyme From Potato
PDB2oww_A0905818496A Chain A, Structure Determination And Refinement At 1.8 A Resolution Of Disproportionating Enzyme From Potato
PDB2owc_A0905818496A Chain A, Structure Of A Covalent Intermediate In Thermus Thermophilus Amylomaltase
PDB1fp9_A0905815493A Chain A, Structure Of A Covalent Intermediate In Thermus Thermophilus Amylomaltase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO4350354791105870
JG8887382821874680
GO8480792952735660
JG8942622752375110
JG9291052632405020