| Basic Information | |
|---|---|
| Species | Zea mays |
| Cazyme ID | GRMZM2G015804_T01 |
| Family | GH1 |
| Protein Properties | Length: 113 Molecular Weight: 13023.5 Isoelectric Point: 8.8914 |
| Chromosome | Chromosome/Scaffold: 1 Start: 25704471 End: 25706405 |
| Description | beta glucosidase 40 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH1 | 1 | 110 | 2.39622e-43 |
| MNYVKERYNSPTVYITENGMDDGNSPFTSLQNALKDSKRIKYHNGYLNNVAASIKEDGCDVRGYFAWSLLDNWEWAAGYTSRFGLYFVDYKDNLKRHPKN SVQWFKTLLS | |||
| Full Sequence |
|---|
| Protein Sequence Length: 113 Download |
| MNYVKERYNS PTVYITENGM DDGNSPFTSL QNALKDSKRI KYHNGYLNNV AASIKEDGCD 60 VRGYFAWSLL DNWEWAAGYT SRFGLYFVDY KDNLKRHPKN SVQWFKTLLS SS* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02998 | PLN02998 | 1.0e-22 | 3 | 112 | 111 | + beta-glucosidase | ||
| PRK13511 | PRK13511 | 2.0e-23 | 4 | 108 | 112 | + 6-phospho-beta-galactosidase; Provisional | ||
| COG2723 | BglB | 2.0e-28 | 1 | 111 | 111 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | ||
| TIGR03356 | BGL | 4.0e-33 | 3 | 105 | 105 | + beta-galactosidase. | ||
| pfam00232 | Glyco_hydro_1 | 2.0e-36 | 1 | 111 | 111 | + Glycosyl hydrolase family 1. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3GNO | 0 | 1 | 111 | 378 | 488 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-Glucosidase |
| GenBank | ACN29297.1 | 0 | 1 | 112 | 128 | 239 | unknown [Zea mays] |
| GenBank | ACR37999.1 | 0 | 1 | 112 | 412 | 523 | unknown [Zea mays] |
| GenBank | EEC74750.1 | 0 | 1 | 111 | 411 | 521 | hypothetical protein OsI_10506 [Oryza sativa Indica Group] |
| RefSeq | XP_002465651.1 | 0 | 1 | 112 | 397 | 508 | hypothetical protein SORBIDRAFT_01g043030 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3gnr_A | 0 | 1 | 111 | 378 | 488 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
| PDB | 3gnp_A | 0 | 1 | 111 | 378 | 488 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
| PDB | 3gno_A | 0 | 1 | 111 | 378 | 488 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
| PDB | 3ptq_B | 8e-36 | 3 | 109 | 398 | 503 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
| PDB | 3ptq_A | 8e-36 | 3 | 109 | 398 | 503 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| coumarin biosynthesis (via 2-coumarate) | RXN-8036 | EC-3.2.1.21 | β-glucosidase |
| linamarin degradation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-13602 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| lotaustralin degradation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-13603 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| taxiphyllin bioactivation | RXN-13600 | EC-3.2.1.21 | β-glucosidase |
| Hydropathy |
|---|
 |
