y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G017186_T09
FamilyGH3
Protein PropertiesLength: 635 Molecular Weight: 68344.1 Isoelectric Point: 6.4488
ChromosomeChromosome/Scaffold: 1 Start: 276325005 End: 276328290
DescriptionGlycosyl hydrolase family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH31123460
  STRLGIPMIYGIDAVHGHNNVYGATIFPHNVGLGATRDPNLVKRIGAATALEVRATGIQYAFAPCIAVCRDPRWGRCYESYSEDHRIVQAMTELIPGLQG
  DVPQNFTSGMPFAAGKDKVAACAKHFVGDGGTQNGINENNTIIDQQGLMSIHMPAYLDALRKGVSTVMISYSSWNGLKMHANHDLITGFLKGRLNFQGFT
  ISDWEGIDRITSPPGANYSYSVQASILAGIDMIMV
Full Sequence
Protein Sequence     Length: 635     Download
MALLTAPAVA ALLLLFWSAA YGGDAQDQGV PPPYQDASKD VEVRVRDLLA RMTLAEKVGQ    60
MTQIERIVAS PQALRDYYIG SLLSGGGSVP RKQATAAEWV TMVSDFQKAC LSTRLGIPMI    120
YGIDAVHGHN NVYGATIFPH NVGLGATRDP NLVKRIGAAT ALEVRATGIQ YAFAPCIAVC    180
RDPRWGRCYE SYSEDHRIVQ AMTELIPGLQ GDVPQNFTSG MPFAAGKDKV AACAKHFVGD    240
GGTQNGINEN NTIIDQQGLM SIHMPAYLDA LRKGVSTVMI SYSSWNGLKM HANHDLITGF    300
LKGRLNFQGF TISDWEGIDR ITSPPGANYS YSVQASILAG IDMIMVPNNY QNFITILTGH    360
VNSGLIPMSR IDDAVTRILR VKFTMGLFEN PMPDPSLADQ LGKQEHRDLA REAVRKSLVL    420
LKNGKPGDAP LLPLPKKAAR ILVAGSHADN LGYQCGGWTI EWQGDTGRTT VGTTVLDAVK    480
AAVDPSTEVV FAESPDAEFV RSGGFSYAIV AVGEHPYTET KGDSMNLTIP DPGPSTVQTV    540
CAAVRCVTVL ISGRPVVIQP FLGAMDAVVA AWLPGTEGQG VTDVLFGDYG FTGKLPRTWF    600
RSVDQLPMNY GDAHYDPLFP LGFGLTTQGK MYQN*                               660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03080PLN030804.0e-3733617632+
pfam01915Glyco_hydro_3_C3.0e-46418626227+
PRK15098PRK150988.0e-7728626679+
COG1472BglX1.0e-8552460419+
pfam00933Glyco_hydro_31.0e-8753381333+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAD23382.103462830625AF102868_1 beta-D-glucan exohydrolase isoenzyme ExoI [Hordeum vulgare subsp. vulgare]
GenBankAAL58976.103463279677AC091811_25 putative exohydrolase [Oryza sativa Japonica Group]
GenBankADC55526.10346287602beta-D-glucan glucohydrolase precursor [synthetic construct]
RefSeqNP_001051277.103463228626Os03g0749500 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001104913.102263422634LOC541703 [Zea mays]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1x39_A0346285600A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase Isoenzyme Exo1 In Complex With Gluco-Phenylimidazole
PDB1x38_A0346285600A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase Isoenzyme Exo1 In Complex With Gluco-Phenylimidazole
PDB1lq2_A0346285600A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase Isoenzyme Exo1 In Complex With Gluco-Phenylimidazole
PDB1j8v_A0346285600A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase Isoenzyme Exo1 In Complex With Gluco-Phenylimidazole
PDB1iex_A0346285600A Chain A, Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase Isoenzyme Exo1 In Complex With Gluco-Phenylimidazole
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO784016419895060
DR8271233002525510
DV5270462952575510
EE0275632962565510
HO7840164634790.000008