y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G032160_T01
FamilyGH81
Protein PropertiesLength: 753 Molecular Weight: 82029.3 Isoelectric Point: 7.3222
ChromosomeChromosome/Scaffold: 7 Start: 104173693 End: 104176328
Descriptionglycosyl hydrolase family 81 protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH81887260
  VVPDPSRFFAPPLLAAPLPTNSFFQNFVLKNGDQPEYVHPYSVRSPGGAALDICYPSRNHSPSFVIQTFVPDLTVSDAAGSAQRHCVSAFDDLSVTLDVS
  PSLRAHLVRGCPYVTVTTTAGAVDISVASVHAFLDVASCDDSGTKWRLGMNSGQTFLLYASAPIRLAQTTTTQLSAPGFAGAIRVAYLPDASMEPVLDRY
  SRCFPTAGHAALSRPFCVDYAWRKDGPGELLMLAHPLHLRLLADDCPVRVLDDFRYRSIDGDMVGVVGDAWVLRTDPVSPTWHSTRGVSEDGVAEVVAAL
  RADVAGLASTAITTTSSYFYGKAIARAARLALIAEEVGCPDVIPAVQQFLKAAVTPWLDGSFQGNGFFYDAKWGGLVTLQGLKDSGADFGFGIYNDHHYH
  LGYFLYAIAVLSKIDPCWGRKYMPQAYSMVADFMTLSRNKAGASFTRLRMFDLWKLHSWAGGLTEFADGRNQESTSEAVNAYYSAALVGLSYGDAHLVSV
  GATLTALEMLAAQTWWHVREGEGIYEDDFSGNNRVVGVLWANKRDSGLWFAPPEWKECRLGIQLLPVLPISEALFPDVAFVKDLVAWTLPALARDGVGEG
  WKGFVYALEGIYDREAALTKTRALKGHDDGNSLTNLLWW
Full Sequence
Protein Sequence     Length: 753     Download
MRKWTRKLGH TLSRIVTTKP RFAFSQPRPR PRPRPAQPGL PSSQPVSIPP QPPELPPFVP    60
TAMPHHGSHR PPAPPPGGPV FPRATSTVVP DPSRFFAPPL LAAPLPTNSF FQNFVLKNGD    120
QPEYVHPYSV RSPGGAALDI CYPSRNHSPS FVIQTFVPDL TVSDAAGSAQ RHCVSAFDDL    180
SVTLDVSPSL RAHLVRGCPY VTVTTTAGAV DISVASVHAF LDVASCDDSG TKWRLGMNSG    240
QTFLLYASAP IRLAQTTTTQ LSAPGFAGAI RVAYLPDASM EPVLDRYSRC FPTAGHAALS    300
RPFCVDYAWR KDGPGELLML AHPLHLRLLA DDCPVRVLDD FRYRSIDGDM VGVVGDAWVL    360
RTDPVSPTWH STRGVSEDGV AEVVAALRAD VAGLASTAIT TTSSYFYGKA IARAARLALI    420
AEEVGCPDVI PAVQQFLKAA VTPWLDGSFQ GNGFFYDAKW GGLVTLQGLK DSGADFGFGI    480
YNDHHYHLGY FLYAIAVLSK IDPCWGRKYM PQAYSMVADF MTLSRNKAGA SFTRLRMFDL    540
WKLHSWAGGL TEFADGRNQE STSEAVNAYY SAALVGLSYG DAHLVSVGAT LTALEMLAAQ    600
TWWHVREGEG IYEDDFSGNN RVVGVLWANK RDSGLWFAPP EWKECRLGIQ LLPVLPISEA    660
LFPDVAFVKD LVAWTLPALA RDGVGEGWKG FVYALEGIYD REAALTKTRA LKGHDDGNSL    720
TNLLWWLHSR GSVVGDGDAG FGRCCWYRQY CH*                                 780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5498ACF24.0e-51107727685+
pfam03639Glyco_hydro_813.0e-17883730699+
Gene Ontology
GO TermDescription
GO:0016998cell wall macromolecule catabolic process
GO:0033903endo-1,3(4)-beta-glucanase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAZ08905.108174117651hypothetical protein OsI_31170 [Oryza sativa Indica Group]
GenBankEEE69610.108175217693hypothetical protein OsJ_29181 [Oryza sativa Japonica Group]
RefSeqNP_001063051.108175217692Os09g0379900 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001136591.10637521690hypothetical protein LOC100216714 [Zea mays]
RefSeqXP_002462313.1017521729hypothetical protein SORBIDRAFT_02g023660 [Sorghum bicolor]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EE174949256833380
DT94028330763120
DR813739234833160
DT9402822105447530
EE0180342301804090