y PlantCAZyme

CAZyme Information

Basic Information
SpeciesZea mays
Cazyme IDGRMZM2G034575_T02
FamilyGH31
Protein PropertiesLength: 299 Molecular Weight: 33535 Isoelectric Point: 8.1221
ChromosomeChromosome/Scaffold: 9 Start: 146533560 End: 146540053
DescriptionGlycosyl hydrolases family 31 protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH311062980
  TATPCWPGSSSYPDMLNPEIREWWADKFSYENYKGSTPTLYIWNDMNEPSVFNGPEVTMPRDAMHYGDVEHRELHNAYGYYFHMATADGLLKRDKGKHRP
  FVLSRAFFAGSQRYGAVWTGDNSADWDHLKSSIPMVLILGLTGLPFSGADVGGFFGNPEPDLLVRWYQVGAFYPFFRGHAHHDTKRREPWLFG
Full Sequence
Protein Sequence     Length: 299     Download
MDPPPRRLAA PLLLLLLAAA SPAARAWKKD EFRNCNQTPF CKRARTRAPH SLEAPLSLAA    60
GSLAVSPDGS ISAELSHPSR PRPLVLRLSV LPPHALRLQI DEDYSTATPC WPGSSSYPDM    120
LNPEIREWWA DKFSYENYKG STPTLYIWND MNEPSVFNGP EVTMPRDAMH YGDVEHRELH    180
NAYGYYFHMA TADGLLKRDK GKHRPFVLSR AFFAGSQRYG AVWTGDNSAD WDHLKSSIPM    240
VLILGLTGLP FSGADVGGFF GNPEPDLLVR WYQVGAFYPF FRGHAHHDTK RREPWLFG*     300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG1501COG15019.0e-64109298192+
cd06600GH31_MGAM-like2.0e-75110298189+
pfam01055Glyco_hydro_313.0e-85110298190+
cd06604GH31_glucosidase_II_MalA5.0e-92109298197+
cd06603GH31_GANC_GANAB_alpha2.0e-140110298189+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABF94648.10110298191379Neutral alpha-glucosidase AB precursor, putative, expressed [Oryza sativa (japonica cultivar-group)]
GenBankACN26464.10110298283471unknown [Zea mays]
RefSeqNP_001145786.1012981298hypothetical protein LOC100279293 [Zea mays]
RefSeqXP_002468270.13.99931e-4211261127hypothetical protein SORBIDRAFT_01g042750 [Sorghum bicolor]
RefSeqXP_002468270.10110298469657hypothetical protein SORBIDRAFT_01g042750 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3w38_A2e-40110296431638A Chain A, Crystral Structure Of The N-Terminal Subunit Of Human Maltase- Glucoamylase
PDB3w37_A2e-40110296431638A Chain A, Crystral Structure Of The N-Terminal Subunit Of Human Maltase- Glucoamylase
PDB2g3n_F2e-3577294225490A Chain A, Crystral Structure Of The N-Terminal Subunit Of Human Maltase- Glucoamylase
PDB2g3n_E2e-3577294225490A Chain A, Crystral Structure Of The N-Terminal Subunit Of Human Maltase- Glucoamylase
PDB2g3n_D2e-3577294225490A Chain A, Crystral Structure Of The N-Terminal Subunit Of Human Maltase- Glucoamylase
Signal Peptide
Cleavage Site
26
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FL7061821891102980
FE6246341891102980
CA1547341891102980
HO1552661891102980
DN1457251861102950